Dorayaki pisang

Dorayaki pisang смотреть последние обновления за сегодня на .

PANCAKE PISANG LEMBUT ANTI GAGAL!!

353545
4684
139
00:03:15
19.09.2020

PANCAKE PISANG LEMBUT Bahan-Bahan: 2 buah pisang 10 sdm tepung terigu 1 sdm gula 1/2 sdt baking powder double acting/1 sdt baking powder biasa 1 butir telur 1/4 sdt vanili bubuk 1/4 sdt garam 110 ml susu cair 2 sdm minyak/margarin #pancakepisang #masaksamasaya #dirumahaja

Resep Dorayaki / Pancake 🥞 Pisang , HANYA 1 TELUR ! PAKAI TAKARAN SENDOK

5587
46
5
00:08:02
11.03.2021

cara membuat Dorayaki dari pisang / Bisa juga dijadikan Pancake pisang . untuk posangnya optional ya bisa pakai atau tidak BAHAN - BAHANNYA - Bahan - Bahan : - 1 butir Telur (uk.sedang) - 3,5 sdm gula pasir - Vanilli / Vanilla (secukupnya) - 10 sdm Tepung terigu - ½ Sdt Soda kue - ¼ Baking Powder - 140ml Susu Cair (SKM dicairkan) - 1 sdm Margarin Cair - 2 buah Pisang (optional) Isian : * Selai Coklat * Gula Halus (sesuai selera) . . jangan Lupa Subscribes channel ini .. tunggu resep" menarik lainnya . . Subscribes , Like & Comment follow instagram dibawah ini : dinda_verell8 . Subscribes juga Youtube channel dibawah ini : Dinda Verella . thankyou for watching

PANCAKE PISANG LEMBUT, MUDAH TAKARAN SENDOK

227940
3583
113
00:03:23
22.04.2020

PANCAKE PISANG LEMBUT, MUDAH TAKARAN SENDOK . Pancake Pisang . untuk 6 buah pancake . Bahan-bahan: 1 buah pisang (ukuran sedang) 1 butir telur 3 sdm gula 12 sdm tepung terigu (protein sedang) 1 sdt baking powder 1/8 sdt garam 6 sdm (100ml) susu UHT 1 sdm minyak sayur . Bahan tambahan: sirup maple atau madu potongan pisang . . Banana Pancake . for 6 pancake . Ingredients: 1 banana (medium size) 1 egg 3 sugar 12 tbsp all purpose flour 1 tsp baking powder 1/8 tsp salt 6 tbsp (100ml) whole milk 1 tbsp vegetable oul . additional ingredients: maple syrup or honey banana (cut in pieces) 🌸 PLEASE di LIKE...SUBSCRIBE...COMMENT... & SHARE yaaa😘😍😍THANK YOU dan semoga bergunaa🙏😊😍❤❤ 🌸 Business inquiries: trivinapink🤍gmail.com 🌸 Bagi teman-teman yg sudah nyobain resep-resep dari Trivina Kitchen, tolong di foto atau di video hasilnya yaa dan tolong di Tag 🤍trivinakitchen di Instagram stories. Saya akan repost di story Trivina Kitchen. Terima Kasih🙏😊😍 🌸 My sosial media: Facebook: 🤍 Instagram: 🤍 🌸 Video saya hanya di Upload di Youtube, Facebook dan Instagram milik Trivina Kitchen. Dilarang untuk mencuri, mengedit dan me Reupload video ini. My video is only uploaded to Trivina Kitchen's YouTube, Facebook and Instagram. Unauthorized theft of this video or 2nd edit and reupload is prohibited 🌸Resep Kue lainnya dari Trivina Kitchen BATIK CAKE 🤍 OREO CAKE 🤍 HURRICANE SPONGE CAKE 🤍 #bananapancake #stayathome #trivinakitchen

Resep Dorayaki Pisang/Pancake Pandan Pisang

7012
74
27
00:08:52
16.09.2021

Resep dorayaki atau pancake sederhana ini mempunyai tekstur yang lembut ya,,,,apalagi di padu dengan aroma pandan dan isian pisang yang menjadi pancake pisang ini harum dan enak.. berikut bahan bahannya : Bahan pancake: *200 gr tepung terigu *4 sdm gula pasir *2 butir telur *1 bks santan cair *pewarna pandan *1 sdt baking soda *100 ml air *3 sdm susu bubuk Bahan isian: *3 buah pisang *sejumput garam *1 bkss vanili bubuk *2 sdm gula pasir #pancake #pancakesederhana #pancakelembut #pancakepisang #dorayaki #dorayakiteflon #resepdorayaki #dorayakipisang #idejualan

resep DORAYAKI, mulus, glowing dan bersarang

113165
1566
124
00:08:04
02.12.2020

jangan lupa dukung channel ini dengan cara LIKE, COMMENT, SHARE, SUBCRIBE terimakasih bagi yang sudah mendukung jangan lupa juga di FOLLOW ya.. supaya tidak ketinggalan video terbaru dari kita

CEMILAN 3 BAHAN 5 MENIT JADI TEMEN MINUM TEH

595709
5170
181
00:04:28
22.10.2020

CEMILAN 3 BAHAN 5 MENIT JADI TEMEN MINUM TEH Bahan : - 4 buah pisang matang apa aja - 1 butir telur - 3 sdm penuh tepung terigu * jika suka agak manis boleh tambah 1 sdm gula pasir / 1 sdm kental manis * boleh tambahkan sedikit garam Kalau sudah coba resepnya jangan lupa tag green di instagram dan pakai #zackligreen Terimakasih🙂 Instagram : 🤍zackligreen Cara buat : Tonton videonya sampe habis ya teman, karna setiap detiknya ada tips & trik yg biasa ditanyakan agar pembuatan berjalan lancar, semoga berhasil.. Selamat mencoba👌 #cemilan3bahan #pisang

Punya Pisang yg terlalu matang dan sudah menghitam,jgn dibuang,dibikin ini saja dijamin jd rebutan

412673
4265
279
00:10:51
17.05.2020

Bahan: 2 buah pisang mateng 2 butir telur 100 ml susu cair 40 gr gula 130 gr tepung protein sedang nah bahanya simple dan mudah yuk tunggu apalagi untuk caranya tonton vidionya ya jgn lupa subscribe dan aktifkan tombol loncengnya trimakasih #olahanpisang #dorayaki #bananapancake

Resep Dorayaki super lembut dan enak - lebih irit & mudah

890476
12602
503
00:05:04
10.03.2021

#dorayaki #resepdorayaki #doraemon Hallo mommies..Satu lagi nih resep kue tanpa mixer buat cemilan anak anak, rasa dorayaki nya yg lembut & empuk ditambah sama selai kesukaan pasti semua suka. Resep Dorayaki bahan bahan : 2 butir telur 80gr gula pasir 1sdm madu 1 sdt pasta vanilla 130gr tepung terigu 1/2 sdt soda kue 50 ml air Cara membuat : 1. Kocok telur, gula, madu & pasta vanilla kedalam mangkuk. Aduk hingga gulanya larut 2. Masukan terigu, soda kue dan garam sambil di ayak. Aduk rata 3. Tuangkan air, aduk kembali sampai semua bahan tercampur rata 4. Istirahatkan adonan selama 10 menit 5. Siapkan teflon, nyalakan kompor & gunakan api kecil 6. Masukan 1 centong adonan diatas teflon yg sudah dipanaskan. 7. Tunggu sampai keluar gelembung, pecah & membentuk pori pori, lalu balik 8. Masak satu sisinya lagi sampai agak kecoklatan. Angkat 9. Olesi satu sisi dorayaki dengan selai cokelat, lalu tumpuk dengan dorayaki lainnya. Tekan bagian pinggirannya hingga menyatu.

MARTABAK PISANG - IDE BISNIS MODAL KECIL PALING LARIS #196

762045
11588
309
00:07:07
08.08.2020

"Martabak Pisang" Bahan : - 6 buah pisang Ambon kecil - 1 SDM mentega + 2 SDM gula + 1 - 2 SDM maizena - 1 butir telur - 6 SDM maizena - 4 SDM terigu - 3 SDM gula - 1 SDM susu bubuk - 1 sdt backing powder - air secukupnya ✓ [diamkan 15 menit panggang di atas pan] ✓ jika menggunakan pisang kepok/raja nangka/tanduk tidak perlu penambahan maizena.. #MartabakPisang #OlahanPisang #IdeBisnisModalKecil

RESEP DORAYAKI TANPA TELUR

617670
17554
632
00:04:08
25.11.2020

Hallo semuanya kali ini saya akan membuat dorayaki tanpa telur, dorayaki ini sangat enak dan lembut meskipun tanpa telur, dan tentunya mudah dibuat, bahannya sangat sederhana siapapun dapat membuatnya. Maka silahkan menikmati menonton. Resep dorayaki tanpa telur Bahan-bahan : 130 gr tepung terigu serbaguna (segitiga biru) 70 gr gula halus 1/2 sdt soda kue 25 gr susu bubuk 1 sdm madu 160 gr susu cair Filling Hazelnut / bisa di ganti dengan pasta kacang merah Selamat mencoba semoga bermanfaat, dan jangan Lupa Subscribe,Like, Share,Komen iya agar tidak ketinggalan Vidio terbaru selanjutnya Terima kasih. Italian Morning oleh Twin Musicom dilisensikan berdasarkan lisensi Creative Commons Attribution 4.0. 🤍 Artis: 🤍

CARA MEMBUAT PANCAKE 2 BAHAN LEMBUT TANPA BAKING POWDER, TAKARAN SENDOK

4311582
67875
3131
00:04:52
10.01.2021

halo semua , kembali lagi di eric’s cooking outside channel , nah kali ini kita akan masak makanan yang simple yang biasa kita makan saat sarapan atau juga bisa di nikmati untuk hidangan penutup dan bisa kita kreasikan sedemikian rupa , nah kali ini kita akan masak pencake , tentu saja menu ini sangat mudah , hanya bermodalkan telur dan tepung kalian sudah bisa membuat menu ini .. jadi ini dia video kita kali ini cara membuat pencake fluffy tanpa baking powder , hanya 2 bahan lembut takaran sendok, jadi ga usah bingung harus ngitung berapa gram berapa gram , karena ini semua memakai takaran sendok ya .. ini dia nih resepnya : 1. tepung terigu self raising flour 180gram / 15sendok makan(kalau tidak ada bisa gunakan tepung terigu protein sedang ditambah 2 sdt baking powder) 2. telur 1 butir thats it! air putih (bahan tambahan) atau bisa gunakan susu 200ml / 20 sendok makan dan gula optional. kalian bisa kreasikan dengan toping sesuai selera ya .. di video ini saya menggunakan madu , namun kalian bisa gunakan susu kental manis atau whip cream atau bisa di kreasikan dengan buah dan saos coklat sesuai selera kalian.. oh ia tonton juga video kita yang ini kalau kalian suka dengan masakan manis .. link di bawah ya .... 🤍 🤍 so thanks for whaching jangan lupa Like, Komen , Share , dan SUBSCRIBE!! peace 🙏🏻😇 #asmrcooking #pancakefluffy #pancakesederhana #pancaketanpabakingpowder #tanpabakingsoda #pancakelembut

RESEP DORAYAKI PISANG, CAMILAN ENAK KESUKAAN BOCIL

86
0
0
00:04:56
16.11.2022

Yuk bikin dorayaki pisang dijamin simpel dan enak, pas banget buat camilan enak kesukaan bocil bocil, selain enak nggak perlu modal banyak apalagi ditanggal tua begini,, pasti nolong banget buat para mama dirumah yang Anakya doyang ngemil tapi dompet tipis 🤣🤣 Yuk tonton 🤍varendofficial1055 jangan lupa untuk subscribe,like, share, dan komen ya,,, terima kasih 😘😘😘

RESEP DORAYAKI | JAPANESE PANCAKE DORAYAKI

24833862
946908
17086
00:04:05
06.08.2020

Hallo semuanya kali ini saya akan membuat dorayaki - Japanese pancake dorayaki, dorayaki ini sangat enak, lembut dan mudah dibuat, bahannya sangat sederhana siapapun dapat membuatnya. Maka silahkan menikmati menonton. Bahan-bahan : 2 butir telur 40 gr / 4 sdm gula pasir 1 sdm madu 1/2 sdt Vanilla ekstrak 90 gr / 9 sdm tepung terigu (segitiga biru) 1 sdt baking powder 10 ml / 2 sdm air (bisa di ganti dengan susu cair) Filling Selai coklat kacang / sesuai selera Silahkan Aktifkan subtitel untuk melihat terjemahan teks ke dalam bahasa anda.✅ Jika Anda menyukai video ini, jangan lupa untuk Klik Like dan membagikannya dengan teman-teman Anda, Berlangganan 👇 youtube.com/c/DelmiraCooking Aktifkan lonceng 🔔 untuk mendapatkan notifikasi tentang video terbaru kami, Terima kasih. #dorayaki #pancake #kuedorayaki

MURAH BANGET!!! KUE DORAYAKI JUALAN DI PINGGIR JALAN

71611
430
71
00:05:09
23.11.2018

#kubiler #dorayaki #yukmakanyuk Hallo temen-temen Selamat datang di CHANNEL KUBILER, Kuliner Bikin Ngiler "Yuuu Makan Yuuu" Kue DORAYAKI cuma 1.000 ????? SUBSCRIBE I LIKE I SHARE I COMMENT Follow me on INSTAGRAM 🤍

resep pisang dorayaki

1253
34
0
00:00:46
19.05.2022

PANCAKE PISANG | TANPA TELUR | ENAK DAN MUDAH

5634
69
19
00:03:41
05.02.2021

PANCAKE PISANG | TANPA TELUR | ENAK DAN MUDAH Bahan-bahan : -2 buah pisang hijau -7 sdm tepung terigu -1 sdm gula pasir -1/4 sdt garam -1/4 sdt baking powder -sejumput vanili bubuk -1 sachet skm -70 ml air -1 ½ sdm minyak goreng Teflon maxim anti lengket : 🤍 Wishker/alat pengocok telur : 🤍 kalau mau tau cara buatnya tonton videonya sampai habis :) Selamat mencoba dan semoga bermanfaat :) Please Subscribe like dan comment ya agar aku lebih semangat lagi dalam membuat video resep-resep sederhana lainnya. Jazakumullohu khoiron :) #pancakepisang#pancakepisangtanpatelur#

Dorayaki - Bamboe Tepung Pisang Goreng

2488
36
3
00:01:33
28.11.2017

Memasak bersama Bumbu Bamboe Bamboe Flour - Tepung Pisang Goreng Dorayaki Facebook: 🤍 Instagram: 🤍 Twitter: 🤍 🤍ptbamboe.com

DORAYAKI PISANG SUSU BISA DIJUAL

311
9
0
00:06:36
25.09.2019

Hi, Temen-temen kali ini saya share cara membuat dorayaki pisang susu bisa juga di jual dengan macam isian Bahan 250 gram tepung terigu protein sedang 4 butir telor ayam 50 gram gula pasir 50 sirop pisang susu ( saya pakai tampolay ) 1 sdt baking powder 150 ml air Jika Berkenan Mohon like,share dan subscribe ya semoga bermanfaat

Dorayaki Pisang

117
27
1
00:02:52
07.07.2020

Membuat dorayaki Pisang ala kak Cello #cello

SAYA SENANG MEMBUAT KUE LEZAT INI!! SUPER ENAK DAN LAKU DALAM SEKEJAP - RESEP KUE DORAYAKI JUAL 1000

234984
4063
269
00:08:01
06.06.2022

#dorayaki #dorayaki1000an #idejualanmodalsedikit #jajanansd #keluargahamzah Assalamualaikum, inget Doremon inget Dorayaki 🤭 Yuk buat anak-anak suka. DORAYAKI 1000AN by 🤍KELUARGAHAMZAH Wajan Crepes / Wajan Datar Diameter 28 cm 🤍 Bahan-bahan: 1 butir telur ayam (1500) 1,5 sdm gula pasir 1/4 sdt garam 1/2 sdt Soda Kue/ Baking Powder 100gr terigu (1000) 100ml air 50gr selai cokelat (1000) Gas + Mika (2000) Jual sesuaikan di tempat masing-masing. Kalau aku jual 1000an yang penting lancar ☺️ Terus dukung chanel kami dengan Like, Komen, dan Subscribe. Follow juga yuk 👇 Facebook 🤍 Instagram 🤍 Tik Tok 🤍 Perlengkapan aku beli disini 👇 Loyang Pizza Mini Diameter 8 Cm 🤍 Wajan Crepes / Wajan Datar Diameter 28 cm 🤍 Teflon Maxim 20 Cm 🤍 Batu Bakar Granito 🤍 Sosis Sobat 🤍 Timbangan Digital Nankai 🤍 Wadah Thinwall Persegi Panjang 1000ml 🤍 Cetakan Takoyaki 25 Lubang 🤍 Mie Lidi & Mie Gepeng Mentah 500gr 🤍 Saos Mc Lewis 500gr 🤍 Cetakan Permen Squid Game 🤍 Plastik Es Mambo Ukuran 3x20cm 🤍 Cetakan Puding Telur Puyuh 🤍 Suntikan Mainan Anak - Anak/ Spuit 🤍 Standing Pouch Minuman / Drinkpack ukuran 9x15 Cm 🤍 Mesin Gilingan Mie / Alat Pembuat Mie 🤍 Cetakan Puding Ikan Koi Kecil 🤍 Stick Es Krim Kayu Tebal 🤍 #idebisnisrumahan #idebisniskekinian #idebisnisrumahtangga #jajananterbaru #jajananviralkekinian #jajananviral #jajananenak #jajanansd #jajananunikkekinian #jajananunikmurahmeriah1000an #idejualan1000an #resepdorayaki #dorayakisederhana #keluargahamzah

Dorayaki Pisang

46
9
6
00:01:19
19.04.2021

Pernah punya pengalaman beli pisang sampai matang sekali sehingga kulit luar pisang berwarna hitam, jadi isinya lembek, bisa loh buat penganan Dorayaki Pisang dengan bahan : - Pisang - Gula - Terigu - Susu Cair - Telur Toping : - Susu kental manis - Gula aren Don't forget to subscribe, like, comment and share my video to supporting my Youtube channel. Find and follow me in: IG : 🤍 Blog : 🤍 Twitter: 🤍 #belajar#masak#masaksendiri#resep#resepmasak

CARA MEMBUAT PANCAKE PISANG TANPA TELUR || OLAHAN PISANG YANG ENAK BANGET

1949
41
36
00:09:41
26.07.2020

CARA MEMBUAT PANCAKE PISANG TANPA TELUR || OLAHAN PISANG YANG ENAK BANGET Assalmualikum Warrahmatullahi wabarakatuh.. Di video kali saya mau buat olahan dari pisang yaitu dorayaki/pancake pisang.. sebelumnya saya sudah pernah bikin video olahan pisang lainnya silahkan cek videonya disini 🤍 dan 🤍 nah dorayaki/pancake pisang ini bahan2nya juga muudah didapat, dibuat tanpa telur, tanpa mentega tapi rasaanyaa enaakkk, kalian wajib coba.. bahan bahan - 5 buah pisang kecil2 - 4-5 sdm tepung terigu - 2 sdm gulA putih - 1/2 sdt soda kue - 1 sdm white cofee - 4 sdm air putih Untuk cara pembuatannya bisa nonton videonya sampai habis yaa... Follow IG : 🤍 Add FB : 🤍 Terimkasih buat teman2 yang mendukung chanel ini dngn cara nonton, Like ,coment dan subscribe...buat yg belum jangan lupa subscribe yaa dan bagikan ke media sosial kalian, siapatau ada teman kalian yg membutuhkan resep olahan pisang ini, Terimakasih #pancakepisang #pancaketanpatelur #pancakepisangtanpatelur #pancakepisangtanpamentega #pancakepisangummuhanifcooking

Resep Dorayaki Pisang Coklat Meleleh

39
0
0
00:09:07
27.07.2020

Resep Dorayaki Pisang Coklat Meleleh

Membuat dorayaki selai coklat lumer dengan isian pisang. Resep dorayaki. Japanese pancake dorayaki.

2403
93
2
00:04:32
13.06.2022

Membuat dorayaki selai coklat lumer dengan isian pisang. Resep dorayaki. Japanese pancake dorayaki. ● Follow me on Instagram : 🤍 Recipe : (Cake Dorayaki) 140 gr flour (140 gr tepung terigu) 2 egg (2 telur) 85 gr granulated sugar (85 gr gula pasir) 1 tbsp honey (1 sdm madu) 1/2 tsp baking powder (1/2 sdt baking powder) 160 ml fresh milk (160 ml susu cair) 1,4 gr vanillie powder (1,4 gr vanili bubuk (Jam Chocolate) 44 gr milo powder (44 gr / 2 sacet milo) 20 gr chocolate powder (20 gr bubuk coklat) 20 gr flour (20 gr tepung terigu) 40 gr granulated sugar (40 gr gula pasir) 200 ml fresh milk (200 ml susu cair) 35 gr margarine (35 gr margarin) 1 tbsp sweet condensed milk (1 sdm susu kental manis) 2 banana (2 buah pisang) #resepdorayaki #recipedorayaki #dorayaki

Dorayaki Pisang Chia Seeds

8
0
0
00:00:32
14.04.2021

Dorayaki Pisang Chia Seeds dengan susu cair Morinaga Chil*Go! Original

RESEP PANCAKE LIPAT VLA PISANG | IDE JUALAN IDE CEMILAN YG UNIK DAN SIMEPL

3061
72
65
00:07:18
18.01.2021

🌷 RESEP PANCAKE 🌷 Bagi temen temen yang suka ngemil dan jualan ini wajib di coba banget bahannya yg sederhana dan buatnya juga cepat rasanya eneak banget Yuk simak bahan bahannya ya Bahan pencake 300 grm tepung terigu 2 sdm susu bubuk 1 sdt beking soda 7 sdm gula pasir 1/4 sdt garam Sejumput vanili bubuk 1 butir telur 400 mil air Bahan vla 4 buah pisang ambon 1 sdm gula pasir 1 sdm tepung maizina 2 sdm mentega /minyak Untunk cara membuat nya silahkan tonton videonya sampai selesai ya Terimakasih _ Jangan lupa dukung cenel ini dengan cara SUBSCREB LIKE & KOMEN TERIMAKASIH _ #pancake #recipepancake #bananpancake #reseppancake #pancakelipatvlapandan #caramembuatpancake #pancakebanana

Resepi Pancake 3 Bahan Tanpa Baking Powder Sangat Mudah Dan Sedap

247551
2621
73
00:05:12
28.05.2022

Resepi Pancake 3 Bahan Tanpa Baking Powder Sangat Mudah Dan Sedap 🇼 🇪 🇧 🇸 🇮 🇹 🇪  🤍 🇸 🇺 🇧 🇸 🇨 🇷 🇮 🇧 🇪  𝗵𝗲𝗿𝗲 👇 🤍 🇫‌🇦‌🇨‌🇪‌🇧‌🇴‌🇴‌🇰‌ 🤍 𝗦𝘂𝗸𝗮𝘁𝗮𝗻 𝗚𝗿𝗮𝗺 𝗸𝗲 𝗖𝗮𝘄𝗮𝗻 🤍 𝗘𝗻𝗴𝗹𝗶𝘀𝗵 𝗦𝘂𝗯𝘁𝗶𝘁𝗹𝗲 , 🤍 𝗕𝗮𝗵𝗮𝗻 , 3 biji ( Telur ) 60 g ( Gula ) 60 g ( Tepung Kek / Tepung Serbaguna ) 𝗣𝗮𝗻𝗰𝗮𝗸𝗲 𝗧𝗮𝗻𝗽𝗮 𝗧𝗲𝗹𝘂𝗿 🤍 #resepi #souffle #pancake

KHUSUS PEMULA!! 1 TELUR SAJA!! – TANPA MIXER TANPA CETAKAN – TIPS ANTI KEMPES!

1650724
53630
843
00:08:04
03.02.2022

Bismillah Banyak banget yang nanyain gimana kalau Souffle Pancake yang kemaren dibuat tanpa mixer? Dibuat tanpa cetakan dll. Tanpa Mixer?? Bisa!! Pakai whisk, dan temen-temen harus sabar yaa.. total waktu yang aku perlukan untuk mengocok putih telur dengan whisk adala 16 menit. Sampe pegel tangan huhu. Gapapa.. itung-itung olahraga dikiit haha. Tetep sih rekomendasi pakai mixer. Karena cara ini bener-bener khusus buat pemula dan yang pengen olahraga hehehe. Sementara kalau dibuat tanpa cetakan? Bisa! Karena aslinya souffle pancake jepang cukup disendok2in gitu aja ke pan. Kita bisa masukkan plastic segitiga supaya lebih mudah aja. Tantangannya masih sama. Bikin ini tuh gampang-gampang susah. Api kompor harus keeeeciiiil banget. Panggang selama 8-10 menit. Usahakan matang merata dan tidak gosong. Kalau udah dipanggang 8-10 menit hasilnya gosong berarti apinya masih kurang kecil. Kalau masih kurang matang juga, bakalan cepet kempes. Ikutin step by step sesuai di video yaa.. Hasil yang di video itu udah yang paling perfect menurutku, setelah aku nyobain sampe ke empat kalinya! Matangnya pas, lembutt banget, pinggirannya pun lembut 😊 Ini resep khusus pemula.. Untuk yang ada info budgetnya cek video ini: 🤍 sama aja kok, beda rasio aja. INFO BUDGET di deskripsi paling bawah di link video tersebut. Pan yang aku pakai di sini adalah Cosmo Pan Series dari Steincookware. Panci anti lengket dengan SET 3 IN 1, Bikin masak di dapur makin semangat, mudah dan seru! Karena masak tanpa lengket bebersih panci juga gak repot 👋 Untuk Link pembeliannya kalian bisa klik di sini: Shopee: 🤍 Instagram : 🤍 Tiktok : 🤍steincookware Business Inquiries: hellodapurumi🤍gmail.com - BAHAN-BAHAN - 1 kuning telur - 17 gram terigu protein rendah (1,5 sdm lebih munjung ya) - 15 ml susu cair full cream - ¼ sdt pasta vanilla (secukupnya) - 1 putih telur - 15 gram gula pasir (1 sdm) TOPPING : Sesuaikan selera (gula halus/madu/butter/buah-buahan/whipped cream/custard cream/glaze) aku pakai glaze vanilla, beli di toko bahan kue. Ditambah matcha bubuk. Kalau udah cobain resep ini, upload foto hasilnya di feed/story instagram dan tag 🤍dapurumi_channel :) PERHATIAN : - Video ini hanya ditayangkan di Youtube (Dapurumi) dan Fanspage Facebook (Dapurumi Channel) - Dapurumi tidak memiliki akun sosial media selain youtube (dapurumi), Fanspage Facebook (Dapurumi Channel), dan Instagram (🤍dapurumi_channel) - SANGAT DILARANG untuk mengedit sebagian atau keseluruhan isi video dan mengupload ulang (re-upload), karena itu adalah pelanggaran hak cipta. Terima kasih :)

Olahan pisang ambon [ Dorayaki pisang keju susu]

436
89
85
00:08:33
24.03.2021

Dorayaki adalah kue yang berasal dari Jepang. Dorayaki termasuk ke dalam golongan kue tradisional Jepang. Kue ini bentuknya bundar sedikit menul. Dorayaki pisang keju susu Bahan - bahan : 4 buah pisang 300 gr tepung terigu 5 sdm gula pasir 1/2 sdt garam 1 bks vanili bubuk 1 sdt baking powder 1 sdt baking soda 2 butir telur 3 sdm mentega cair air secukupnya Isian : Keju cheddar Susu kental manis [Boleh isian selai coklat atau sesuai selera] Cara membuat bisa dilihat di video nya ya, Moms. Terima kasih sudah mampir di channel Mami May, semoga suka dan bermanfaat. Jika suka, boleh like, komen dan share yaa.

Kue dorayaki rasa pisang

34
2
0
00:04:40
07.03.2020

Dorayaki Pisang, Olahan Sehat Antidiare - OKK RK 101

22
2
0
00:03:52
05.01.2022

Halo semuaa. Di video kali ini, kami dari kelompok OKK RK 101 ingin berbagi resep masakan sehat yang berkhasiat bagi tubuh untuk mencegah penyakit diare, yaitu membuat dorayaki pisang! Pada tau gak, pisang itu bermanfaat loh untuk mencegah diare. Yuk, simak pembuatannya di video ini. Selamat mencoba ! 😆☺️ Tim 3 OKK RK 101: 1. Abner Abhista Triyono (110110210335) 2. Alya Oktari (120104210017) 3. Angelica Febri Maribeth Valentina Siregar (160110210029) 4. Grace Victory (170304210039)

DORAYAKI PISANG ((Tugasan Akhir Semester))

11
3
1
00:10:49
23.03.2021

Created by InShot 🤍

Roti Dorayaki Inti Coklat Chipsmore & Pisang | Roti Dorayaki Goreng | #resepirotidorayakigoreng

278
10
5
00:08:09
09.05.2020

#rotidorayakigoreng #rotidorayakicoklatpisang #rotidorayakicoklatpisang Bulan puasa macam ni, beli roti selalu tak habis. Kadang-kadang dah dekat nak expired pun masih berbaki lagi. Maka sebelum sampai waktu nya roti rosak lebih baik kita manfaat kan. Boleh cuba buat roti ni sangat sedap dan rangup diluar. Coklat dan manis nya pisang memang kombinasi yang sangat sedap.

100% PASTI Fluffy! Resep Pancake Jepang Selembut Kapas [Bahan Lokal]

826033
19034
421
00:09:02
21.08.2020

*English description is at the bottom section.* Matikan subtitle: Settings - Subtitle/CC - Off 00:00 : intro 00:55 : persiapan bahan (prepping the ingredients) 02:21 : mulai membuat adonan pancake (making the pancake batter) 04:12 : mulai memasak (start of cook) 04:51 : membuat saus Ovomaltine (making the Ovomaltine sauce) 05:53 : hidangan siap dan dan tahap plating (the dish is ready to plate and serve) = [INDONESIAN] Resep Fluffy Pancake. Fluffy pancake adalah pancake yang memiliki tekstur seperti spons, lembut, dan mengembang. Membuatnya cukup mudah, kuncinya ada di putih telur yang dikocok hingga mengembang dan kaku. Fluffy pancake semakin nikmat disajikan dengan saus Ovomaltine dan potongan buah stroberi. Resep Whip Cream Krimer 🤍 Resep Fluffy Pancake (6 pcs) Bahan adonan pancake: 2 butir kuning telur 75 gr susu cair 20 gr minyak 85 gr tepung terigu protein sedang 1 sdt baking powder ¼ sdt ekstrak vanila 3 butir putih telur 30 gr gula pasir 1 sdt cuka Saus Ovomaltine: 150 ml whip cream 3 sdm Ovomaltine Crunchy Cream 1-2 sdm susu cair Garnish: 6 buah stroberi 1 sdm cokelat bubuk Langkah: 1. Kocok kuning telur, susu cair, minyak, dan ekstrak vanila aduk rata 2. Tambahkan tepung terigu dan baking powder yang sudah diayak, aduk hingga rata 3. Kocok putih telur, cuka, dan gula pasir hingga kaku yang jika dibalikkan akan seperti paruh burung 4. Tuang ⅓ adonan putih telur ke adonan kuning telur aduk rata, lalu tambahkan sisa adonan dan aduk kembali 5. Panaskan pan anti lengket, olesi dengan sedikit minyak gunakan api kecil 6. Tuang 2-3 scoop adonan kemudian tutup pan masak selama 2-4 menit 7. Balik pancake, tutup lagi dan masak selama 2-4 menit tergantung panas api dan ketebalan pancake 8. Kocok whip cream menggunakan mixer hingga setengah kaku, tambahkan Ovomaltine Crunchy Cream dan susu cair, kocok lagi hingga tercampur rata 9. Sajikan pancake dengan disiram saus ovomaltine. Garnish dengan taburan coklat bubuk dan potongan stroberi Ovomaltine Crunchy Cream tersedia di Ranch Market, Farmers Market, Food Hall, Lion Superindo, Giant, Kem Chicks, Grand Lucky, Indomaret, Supermarket, dan Toko-toko lainnya. Jangan lupa cek Instagram 🤍OVOMALTINE_INDONESIA Instagram: 🤍 Facebook Page : 🤍 = [ENGLISH] Soft Like Cotton: Japanese Fluffy Pancakes Recipe Fluffy pancakes are pancakes with a sponge-like texture that is soft and airy. It's quite easy to make. The key is in the egg whites that are beaten until they expand and stiff. Fluffy Pancakes will taste even better when served with Ovomaltine sauce and strawberry slices. Creamer Whipped Cream Recipe: 🤍 Fluffy Pancakes Recipe (6 pcs) Pancake Batter ingredients: 2 pc egg yolks 75 g milk 20 g oil 85 g all-purpose flour 1 tsp baking powder 1/4 tsp vanilla extract 3 pc egg whites 30 g sugar 1 tsp vinegar Ovomaltine Sauce: 150 ml whipped cream 3 tbsp Ovomaltine Crunchy Cream 1-2 tbsp milk Garnish: 6 pc strawberries 1 tbsp cocoa powder Steps: 1. Whisk the yolks, milk, oil, and vanilla extract. Mix well. 2. Add the sifted flour and baking powder in. Mix well. 3. Whisk the egg whites, vinegar, and sugar until stiff. When it's inverted, it should look like a bird's beak. 4. Pour 1/3 of the whites mix to the yolks mix. Stir well. Add the rest of the whites and mix well. 5. Heat a nonstick pan. Brush with a bit of oil. Cook at low heat. 6. Pour 2-3 scoops of batter. Place the lid on and cook for 2-4 minutes. 7. Flip the pancakes. Place the lid on once more and cook for 2-4 minutes, depending on the heat and the pancake's thickness. 8. Whip some cream with a mixer until it's a bit firm. Add the Ovomaltine Crunchy Cream and milk. Whip it again until it's mixed well. 9. Serve the pancakes with the Ovomaltine sauce. Garnish with cocoa powder and strawberry slices. Ovomaltine Crunchy Cream is available at Ranch market, Farmers market, Foodhall, Lion Superindo, Giant, Kem Chick, Grand lucky, Indomaret, many leading supermarkets, and grocery shops. = Official Site: 🤍 Instagram: 🤍 Business inquiries: contact🤍devinahermawan.com Don’t reupload our content but you can share our videos. Production 2020 © Copyrights by Devina Hermawan. #FeelTheCrunch #KreasiOvomaltine #ResepOvomaltine #ResepPancake #FluffyPancake #ResepDevinaHermawan

cemilan simple dorayaki pisang with better, try this!!! #shortscemilan #dapoerokan

1891
71
2
00:00:59
28.09.2021

🤍DapoerOkan #shortscemilan #olahan pisang

PUNYA PISANG YANG SUDAH KEMATANGAN || DI BIKIN INI AJA || PANCAKE PISANG/Dorayaki Pisang

282
30
101
00:06:07
25.03.2022

punya pisang yang sudah kematangan, di bikin ini aja, pancake pisang cara membuat nya mudah bahan nya: -12 sdm tepung terigu -1/4 garam -1/4 baking powder -1/4 soda kue -1 butir telur -20 sdm air - pewarna opsional #pancakepisang #dorayakipisang #pancake

RESEP PANCAKE DORAYAKI PISANG YANG SUDAH TERLALU MATANG.

133
14
2
00:05:18
14.01.2021

#reseppancakedorayaki #reseppancakedorayakipisang #reseppancake #memanfaatkanpisangyangkematangan #resepmenucemilan #caramembuatpancake #dorayakipisang Deskripsi Hai halo Assalamu'alaikum di video kali ini aku mau membuat pancake dorayaki pisang yang enak banget kesukaan anak-anak tentunya.. aroma pisang nya mantap banget nonton terus video nya sampai habis ya happy watching thank you bahan tepung terigu 13 sdm gula pasir 3 sdm pisang yang sudah kematangan 3 buah susu uht/ cair 200 ml telur 1 butir baking powder 1/2 sdt garam 1/2 sdt minyak goreng 2 sdm untuk caranya bisa dilihat di video ya Subscribe ya karena subscribe itu gratis...

Назад
Что ищут прямо сейчас на