Keshav nagar mundhwa

Keshav nagar mundhwa смотреть последние обновления за сегодня на .

Keshav Nagar, Mundhwa की हालत गाँवों से भी बेकार ! Huge Resentment with PMC | Part- 1

18977
591
100
00:09:59
08.11.2022

In this video we have covered every single corner of Keshav Nagar with its current development. Garbage dumping, less water supply, potholes road, etc. are the main reasons that made all Keshav Nagar society residents united and formed Keshav Nagar Societies Association to address this issues as soon as possible. You can send us your query / concern 👉🏻 🤍 WhatsApp us for detailed discussion👉 🤍 For further assistance you may call us on: +91- 7030771234 Video Chapters; 00:00 Intro 01:16 Manjari Road | Ground Reality | Keshav Nagar Chowk to K-City 04:00 Mahaganesh Nagari Facts 04:16 Renuka Mata Mandir Road | Amrai | Unique Legacy Work Progress 05:46 Keshav Nagar Road | Vertical Oriana Work Progress 06:55 Kumbharwada - Interesting Facts 07:19 Road Condition of Keshav Nagar 07:58 Reality of Keshav Nagar 09:59 End Real estate sector in Pune has escalated by leaps and bounds in less than a decade. The cultural capital of Maharashtra has been growing significantly with the advent of IT sector, globalization and industrialization. Every year new buyers ingress the market seeking for property investments thus creating an evident demand, on the other hand developers come up with new and cutting-edge technology projects year after year to cater the supply thereby continuing the cycle. New property buyers are not only the natives but also the nonresidents who’ve been looking for investing in a potential location. While this may seem a big opportunity for the investors, it has also been a major challenge for them with an ever-growing swarm of scamsters. SaudaGhar is an initiative to educate the buyer in every possible aspect. We at SaudaGhar, have been constantly thriving to empower and acquaint the buyer to make a sound decision while investing in property by understanding their individual needs, purpose, emotions, feelings and risks behind getting a safe and secure investment. We understand that buying one’s dream home involves a lot of framework which varies with individual and personal liberty. Our sole aim is to guide you with a complete 360-degree analysis and unbiased review of the property, location, timely work completion, budget and legalities at your door step, virtually. Our digital platform provides you with the other side of the coin as well which may not be known to you as an end user. This will not just benefit the buyer with secure investments, cost savings but also ensure that the buyer is informed enough about the present scenario to make a right call. The decision for buying/ investing lies solely with the buyer, SaudaGhar abstains from promotion. Our only intention is to educate, guide, and consult you with your problems. We’ve been fortunate enough from our genuine and happy customers for bestowing their love and support throughout our journey. We are more than happy and content to serve and help you resolve your issues. SaudaGhar makes sure that each of our client’s/customer’s query and request has been resolved be it through our active video portal, other social media handles or through our in-person consultation services. Our dynamic and proficient team of professionals helps you with Investment management/portfolio (property) management/capital management/financial advisory/client strategy and consulting. For further assistance SaudaGhar also has an active and efficient ground support team which deals with preliminary and detailed survey for every location and provide you the ground reality and helping you with an end-to-end support. Be it from pre-booking to post-possession, be it pre-construction to post-occupancy, SaudaGhar is here to help you. Think Real Estate, Think SaudaGhar! - ℙ𝕝𝕖𝕒𝕤𝕖 𝕗𝕠𝕝𝕝𝕠𝕨 𝕊𝕒𝕦𝕕𝕒𝔾𝕙𝕒𝕣 𝕠𝕟 𝕠𝕥𝕙𝕖𝕣 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕡𝕝𝕒𝕥𝕗𝕠𝕣𝕞𝕤 𝕒𝕝𝕤𝕠; 𝕀𝕟𝕤𝕥𝕒𝕘𝕣𝕒𝕞👉 🤍 𝕋𝕨𝕚𝕥𝕥𝕖𝕣👉 🤍 𝕃𝕚𝕟𝕜𝕖𝕕𝕀𝕟👉 🤍 𝔽𝕒𝕔𝕖𝕓𝕠𝕠𝕜👉 🤍 𝕋𝕒𝕜𝕒𝕥𝕒𝕜👉 🤍 𝕎𝕖𝕓𝕤𝕚𝕥𝕖👉 🤍 𝔸𝕝𝕝 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕝𝕚𝕟𝕜𝕤👉 🤍

Keshav Nagar Mundhwa वालों के कष्ट देखकर आपके आँखों में आँसू आ जाएँगे Know its Past & Future. Part 2

21461
670
95
00:11:12
12.11.2022

In this Part-2 of Keshav Nagar we have Keshav Nagar, Mundhwa Kharadi bridge latest update. We have covered the remaining part from Renuka Mata Mandir to Puravankara Silversands as well. All facts between this route have been covered and soon we will come with the next part. Stay Tuned. You can send us your query / concern 👉🏻 🤍 WhatsApp us for detailed discussion👉 🤍 Video Chapters; 00:00 Intro 01:36 Renuka Mata Mandir - Godrej Rejuve 02:32 Godrej Rejuve Work Progress 02:50 Kharadi - Keshav Nagar Bridge Current Update 04:39 Past of Keshav Nagar 05:55 Future of Keshav Nagar 06:28 Manjari Road (Lonkar Vasti Ckowk) 07:56 Eastern Ranges 08:24 Godrej Rejuve - Silversands Road 09:40 Puravankara Silversands Current Status 11:12 End Real estate sector in Pune has escalated by leaps and bounds in less than a decade. The cultural capital of Maharashtra has been growing significantly with the advent of IT sector, globalization and industrialization. Every year new buyers ingress the market seeking for property investments thus creating an evident demand, on the other hand developers come up with new and cutting-edge technology projects year after year to cater the supply thereby continuing the cycle. New property buyers are not only the natives but also the nonresidents who’ve been looking for investing in a potential location. While this may seem a big opportunity for the investors, it has also been a major challenge for them with an ever-growing swarm of scamsters. SaudaGhar is an initiative to educate the buyer in every possible aspect. We at SaudaGhar, have been constantly thriving to empower and acquaint the buyer to make a sound decision while investing in property by understanding their individual needs, purpose, emotions, feelings and risks behind getting a safe and secure investment. We understand that buying one’s dream home involves a lot of framework which varies with individual and personal liberty. Our sole aim is to guide you with a complete 360-degree analysis and unbiased review of the property, location, timely work completion, budget and legalities at your door step, virtually. Our digital platform provides you with the other side of the coin as well which may not be known to you as an end user. This will not just benefit the buyer with secure investments, cost savings but also ensure that the buyer is informed enough about the present scenario to make a right call. The decision for buying/ investing lies solely with the buyer, SaudaGhar abstains from promotion. Our only intention is to educate, guide, and consult you with your problems. We’ve been fortunate enough from our genuine and happy customers for bestowing their love and support throughout our journey. We are more than happy and content to serve and help you resolve your issues. SaudaGhar makes sure that each of our client’s/customer’s query and request has been resolved be it through our active video portal, other social media handles or through our in-person consultation services. Our dynamic and proficient team of professionals helps you with Investment management/portfolio (property) management/capital management/financial advisory/client strategy and consulting. For further assistance SaudaGhar also has an active and efficient ground support team which deals with preliminary and detailed survey for every location and provide you the ground reality and helping you with an end-to-end support. Be it from pre-booking to post-possession, be it pre-construction to post-occupancy, SaudaGhar is here to help you. Think Real Estate, Think SaudaGhar! - ℙ𝕝𝕖𝕒𝕤𝕖 𝕗𝕠𝕝𝕝𝕠𝕨 𝕊𝕒𝕦𝕕𝕒𝔾𝕙𝕒𝕣 𝕠𝕟 𝕠𝕥𝕙𝕖𝕣 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕡𝕝𝕒𝕥𝕗𝕠𝕣𝕞𝕤 𝕒𝕝𝕤𝕠; 𝕀𝕟𝕤𝕥𝕒𝕘𝕣𝕒𝕞👉 🤍 𝕋𝕨𝕚𝕥𝕥𝕖𝕣👉 🤍 𝕃𝕚𝕟𝕜𝕖𝕕𝕀𝕟👉 🤍 𝔽𝕒𝕔𝕖𝕓𝕠𝕠𝕜👉 🤍 𝕋𝕒𝕜𝕒𝕥𝕒𝕜👉 🤍 𝕎𝕖𝕓𝕤𝕚𝕥𝕖👉 🤍 𝔸𝕝𝕝 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕝𝕚𝕟𝕜𝕤👉 🤍

KESHAV NAGAR ROAD | MUNDHWA | KHARADI | PUNE | 4K VIRTUAL TOUR

15986
161
47
00:07:34
22.01.2021

🥰 Thanks for taking the time to watch my work. It means a lot. 🛑 Don't Forget To SUBSCRIBE !! 📍 HOW TO REACH - 🤍 📜 Keshav Nagar is a suburb in Pune in proximity to the high-end residential localities such as Kalyani Nagar, Viman Nagar, Koregaon Park etc. The area is gaining prominence due to its location and investment by developers such as Godrej, Godrej Properties, Malkani Properties and Vishal Group. The under-construction bridge planned by Godrej and several other developers between Keshav Nagar and Kharadi is likely to improve its connectivity significantly. The locality has good connectivity with the rest of the city via internal roads in mundhwa Pune. Local transportation via municipal buses provides good connectivity. Pune Railway Station is around 8 km away catering to the area and Pune International Airport is around 8-9 km away.Upcoming bridge between Keshav Nagar and Kharadi likely to improve connectivity Keshav Nagar has good mix of social and retail infrastructure. The locality has schools and colleges likeThe Orbis College, SNBP School, Wisdom World School andPdeas Law College.The area has many nursing homes, hospitals and dispensaries likeAnkur Hospital, Yash Hospital, Shreekunj clinic. Few important malls and market include Amanora Mall (3.5Km), Seasons Mall (3.5 Km),Inorbit Mall (6 km) and Phoenix Market City (7 km) and Nyati Eureka. Keshav Nagar also attracts people who are working in the IT/ITeS sector, as it is close to some of the major IT parks like Magarpatta IT Park (4Km), EON IT Park (5.5Km), Kharadi, (4KM), Kalyani Nagar (6KM). Other important areas of employment in the 8-10 KM vicinity includes Sayyid Nagar, Malwadi etc. Most of the offices and retail markets are on major roads are Manjari Road, Keshav Nagar Road, Belure Road ————————Equipment I use ——————— Primary Camera:- 🤍 Action Camera:- 🤍 (New Model) Microphone:- 🤍 (New model) Moto Microphone:-🤍 Gimble Camera :- 🤍 Memory Cards & HDD ———————————— Memory Card 64 GB:- 🤍 32 GB:- 🤍 HDD:- 1 TB:- 🤍 2 TB:- 🤍 Other Accessories ——————————— Power Bank 10000 amp:- 🤍 Power bank 15000 amp:- 🤍 Go Pro Battery:- 🤍 Go Pro Accessories Kit:- 🤍 Recording Month: January 2021 Video Format: 4K #keshavnagar #mundhwa #kharadi #virtualtour

K-City Project Review | Keshav Nagar Location Overview | Mundhwa Kharadi Bridge Update Pune 2022

13365
292
41
00:07:35
19.08.2022

In this video we have shown K-City which is located in Keshav Nagar. It is spread across 4 acres of land and has a total of 12 towers out of which 1 tower is MHADA and 6 towers have been launched and 5 towers yet to be launched. Do watch the full video to know the detailed analysis of the project. You can send us your query / concern 👉🏻 🤍 WhatsApp us for detailed discussion👉 🤍 For further assistance you may call us on: +91- 7030771234 Video Chapters; 00:00 Intro 00:55 Location Overview 04:48 Project Detail 05:11 Inventories & Pricing 06:15 Pros & Cons 07:35 End Real estate sector in Pune has escalated by leaps and bounds in less than a decade. The cultural capital of Maharashtra has been growing significantly with the advent of IT sector, globalization and industrialization. Every year new buyers ingress the market seeking for property investments thus creating an evident demand, on the other hand developers come up with new and cutting-edge technology projects year after year to cater the supply thereby continuing the cycle. New property buyers are not only the natives but also the nonresidents who’ve been looking for investing in a potential location. While this may seem a big opportunity for the investors, it has also been a major challenge for them with an ever-growing swarm of scamsters. SaudaGhar is an initiative to educate the buyer in every possible aspect. We at SaudaGhar, have been constantly thriving to empower and acquaint the buyer to make a sound decision while investing in property by understanding their individual needs, purpose, emotions, feelings and risks behind getting a safe and secure investment. We understand that buying one’s dream home involves a lot of framework which varies with individual and personal liberty. Our sole aim is to guide you with a complete 360-degree analysis and unbiased review of the property, location, timely work completion, budget and legalities at your door step, virtually. Our digital platform provides you with the other side of the coin as well which may not be known to you as an end user. This will not just benefit the buyer with secure investments, cost savings but also ensure that the buyer is informed enough about the present scenario to make a right call. The decision for buying/ investing lies solely with the buyer, SaudaGhar abstains from promotion. Our only intention is to educate, guide, and consult you with your problems. We’ve been fortunate enough from our genuine and happy customers for bestowing their love and support throughout our journey. We are more than happy and content to serve and help you resolve your issues. SaudaGhar makes sure that each of our client’s/customer’s query and request has been resolved be it through our active video portal, other social media handles or through our in-person consultation services. Our dynamic and proficient team of professionals helps you with Investment management/portfolio (property) management/capital management/financial advisory/client strategy and consulting. For further assistance SaudaGhar also has an active and efficient ground support team which deals with preliminary and detailed survey for every location and provide you the ground reality and helping you with an end-to-end support. Be it from pre-booking to post-possession, be it pre-construction to post-occupancy, SaudaGhar is here to help you. Think Real Estate, Think SaudaGhar! - ℙ𝕝𝕖𝕒𝕤𝕖 𝕗𝕠𝕝𝕝𝕠𝕨 𝕊𝕒𝕦𝕕𝕒𝔾𝕙𝕒𝕣 𝕠𝕟 𝕠𝕥𝕙𝕖𝕣 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕡𝕝𝕒𝕥𝕗𝕠𝕣𝕞𝕤 𝕒𝕝𝕤𝕠; 𝕀𝕟𝕤𝕥𝕒𝕘𝕣𝕒𝕞👉 🤍 𝕋𝕨𝕚𝕥𝕥𝕖𝕣👉 🤍 𝕃𝕚𝕟𝕜𝕖𝕕𝕀𝕟👉 🤍 𝔽𝕒𝕔𝕖𝕓𝕠𝕠𝕜👉 🤍 𝕋𝕒𝕜𝕒𝕥𝕒𝕜👉 🤍 𝕎𝕖𝕓𝕤𝕚𝕥𝕖👉 🤍 𝔸𝕝𝕝 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕝𝕚𝕟𝕜𝕤👉 🤍

क्या सच में Keshav Nagar - Kharadi Bridge Cancel कर दिया गया? Know Current Stage of Bridge #2023

12701
415
82
00:02:02
26.12.2022

Many viewers sent messages to us and commented on the video that what is the situation of Keshav Nagar Kharadi bridge? And many of them wrote that it is being heard that the bridge has been cancelled. When we got a flood of such messages, finally we thought that why not cover such a subject again and bring the whole truth in front of you people. For this purpose, we are bringing this entire Current situation of Mundhwa Kharadi bridge. Where you can clearly see that the work of Keshav Nagar Kharadi bridge is going on fast. Send us your any query related to Real Estate👉🏻 🤍 That means this bridge has not been cancelled. Do not fall for any fake news under any pretext. SaudaGhar will bring you the complete information about what will happen in the future on this bridge. WhatsApp us for detailed discussion👉 🤍 For further assistance you may call us on: +91- 7030771234 Video Chapters; 00:00 Intro 01:01 Bridge Detail Think Real Estate, Think SaudaGhar! - ℙ𝕝𝕖𝕒𝕤𝕖 𝕗𝕠𝕝𝕝𝕠𝕨 𝕊𝕒𝕦𝕕𝕒𝔾𝕙𝕒𝕣 𝕠𝕟 𝕠𝕥𝕙𝕖𝕣 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕡𝕝𝕒𝕥𝕗𝕠𝕣𝕞𝕤 𝕒𝕝𝕤𝕠; 𝕀𝕟𝕤𝕥𝕒𝕘𝕣𝕒𝕞👉 🤍 𝕋𝕨𝕚𝕥𝕥𝕖𝕣👉 🤍 𝕃𝕚𝕟𝕜𝕖𝕕𝕀𝕟👉 🤍 𝔽𝕒𝕔𝕖𝕓𝕠𝕠𝕜👉 🤍 𝕋𝕒𝕜𝕒𝕥𝕒𝕜👉 🤍 𝕎𝕖𝕓𝕤𝕚𝕥𝕖👉 🤍 𝔸𝕝𝕝 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕝𝕚𝕟𝕜𝕤👉 🤍

Major Issues of Keshav Nagar, Mundhwa discussed...

3390
142
13
00:00:49
09.11.2022

Stay Tuned, we are soon coming with Part-2. To watch the Full Video click on the link below👇 🤍

Future of Keshav Nagar, Mundhwa, Pune | Watch Work Progress in 4K Aerial View | Real Estate 2021

29510
496
76
00:09:34
15.04.2021

What is the current situation of Keshav Nagar? And how much this location can grow in the coming few years. All this information you will get through this video. Along with this, we covered the work progress of many projects as well, the names of the projects are mentioned below. 1. Godrej Rejuve 2. Godrej infinity 3. Purvankara Silversands 4. Konark Virtue 5. Venkatesh Graffiti (Elan & Elite) 6. Unique Legacy 7. Mantra Insignia Chapters; 00:00 Intro 00:13 Imp Covid Information 01:21 Keshav Nagar 02:28 Godrej Rejuve Keshav Nagar 03:59 Konark Virtue Keshav Nagar 04:20 Venkatesh Graffiti Keshav Nagar 06:08 Puravankara Silversands Keshav Nagar 07:00 Unique Legacy Keshav Nagar 07:14 Florida Estate Pune 07:38 Problems in Keshav Nagar, Mundhwa 07:58 Keshav Nagar Future Subscribe SuadaGhar for regular update: 🤍 Whatsapp: 🤍 For further assistance you may Call us: +91- 7030771234 #KeshavNagar #MundhwaPune #AerialView *Follow us on our website & other social media* Website: 🤍 Facebook: 🤍 Twitter: 🤍 Instagram: 🤍 LinkedIn: 🤍 Find all social media links at one place: 🤍

K city keshav nagar | Best property in keshav nagar | Sample Flat | Price | Loction | Review

20115
222
58
00:23:32
15.03.2022

KCity Keshav Nagar Pune | 3BHK Sample Flat | 2 & 3BHK Flat in keshav Nagar Inspired by the thought of encouraging you to step out to get your daily dose of outdoor activities and socializing, we have designed open spaces to ensure that you make the most of the time spent outside your home as well. At K City, innovative planning meets cutting edge designs to ensure that you live the life you have always aspired for. HIGHLIGHTS : Project Area - 4 Acres Total Towers - 11 Floors - Basement + Ground + Podium + 13 Floors Flats per Floor - 4 Configuration - 2bhk & 3bhk Price Range - 62 to 79 Lacs DIMENSION : 3BHK Entrance Lobby - 4.8 * 3.11 sq. ft. Living Room - 10.6 * 17 sq. ft. Balcony - 10.6 * 4 sq. ft. Dining - 5.7 * 9.1 sq. ft. Kitchen - 11 * 8 sq. ft. Guest Bedroom - 11 * 12.1 sq. ft. Bedroom 1 - 10 * 12 sq. ft. Common Washroom - 7.6 * 4.6 sq. ft. Master Bedroom - 11.1 * 13.2 sq. ft. Attached Balcony - 11.1 * 3 sq. ft. Master Bathroom - 8 * 4.6 sq. ft. KEY DISTANCES : Pune Airport - 20 mins Pune Railway Station - 20 mins Phoenix Market City - 15 mins EON IT Park - 15 mins The Westin - 12 mins Orbis School - 5 mins Seasons Mall - 10 mins Noble Hospital - 12 mins D-Mart - 10 mins AMENITIES : Infinity Pool GYM Futsal Court Badminton Court Basketball Court Health Bar Club House Children's Play Area Party Lawn Indoor Games Multipurpose Hall Amphitheater Yoga NEAR BY LOCATIONS : Kharadi Magarpatta City Hadapsar Koregaon Park Mundwa Vadgaon Sheri #KCity #KeshavnagarPune #KCityPune Thank you for watching and reading. Make sure to Like & Subscribe, Share if you enjoyed this video. Connect with me - ● Instagram: 🤍 ● Facebook: 🤍 ● Twitter: 🤍 Vlogging Kit DJI OSMO Action Camera 🤍 Mobile Apple Iphone 12 Oppo Reno 6 ULANZI Camera Tripod, Mini Flexible Tripod Stand with Hidden Phone Holder w Cold Shoe Mount 🤍 BOYA by-MM1 Universal Cardiod Shotgun Microphone 🤍

Que 914 Keshavnagar | 2,2.5,3,4 BHK Spacious Apartment | 3 BHK Sample Flat | Rhk Vlogs Official

6077
76
49
00:35:31
22.10.2022

Hey we are here with our whatsapp number Please click the link below to connect directly 🤍 KESHAVNAGAR | 3 BHK SAMPLE FLAT | QUE 914 Keshavnagar | 2, 2.5, 3 & 4 BHK SPACIOUS APARTMENT #QUE914 #QUE_KESHAVNAGAR #UNIQUEPROPERTIES QUE914 offers 2,3 & 4 BHK Luxurious Flats in Keshavnagar, Pune, at an affordable price range of 75 lacs. Large Residences. Unique Que 914 is a residential development in Keshavnagar, Pune. The project is built by Unique Choice Associates. They provide 2BHK, 3BHK, 4BHK apartments with all necessities. FACILITIES Swing Garden Machan House Wall Climbing Area Toddler Cycle Tracks Semi-indoor Play Area Live Board Games Area Trimex Internal Road Fragrant Garden with Hammock ADDITIONAL AMENITIES Mail Area Open Air Gymnasium Co-working Space Sunken Family Pavilion MASONRY • Sand Finish External Plaster • Gypsum Finish Internal Walls • AAC Blocks Masonry DOORS & WINDOWS • Smart Biometric Locks • Laminated Flush Door • Partial Granite Door Frame in Bathrooms. • Powder Coated 3 Track Aluminum Windows with Mosquito Mesh • Powder Coated Aluminum Sliding Door in Living Room • MS Grill for Windows • Granite Window Sill on all 4 Sides • MS Railing in Balcony FLOORING & TILING • 600 mm x 1200 mm Vitrified Flooring Tiles • Designer Anti-skid Tiles in Terraces, Toilets & Bathrooms • Designer Wall Tiles up to Ceiling Level in Toilets & Bathrooms ELECTRICALS • Concealed Copper Wiring • Electrical Switches of Good Quality • Television Point in Living & Master Bedroom • Limited Genset Back-up within the Flat • Fan & Tubelights in Kitchen, Living Room & Bedrooms • Video Door Phone for Each Flat • AC Point in Master Bedroom KITCHEN • Kitchen Platform with Sink • Designer Dado Tiles up to Lintel Level • Provision for Exhaust Fan • Kitchen Trolleys without Overhead Cabinets BATHROOMS • CP & Sanitary Fitting of Good Quality • Provision for Exhaust Fan in Bathroom • Solar Heated Water in Bathroom PAINT • Oil Bound Distemper in the Entire Flat • Semi-acrylic Paint on External Walls #que914 #uniqueproperties #que914keshavnagar #que914keshavnagarpune #projectsinkeshavnagar #newlaunch #uniqueque914 #que914floorplan #que914sampleflatvideo #sampleflattour #que914location #projectsinkeshavnagar #newlaunchkeshavanagar #keshavnagarproperties Thank you for watching and reading. Make sure to Like & Subscribe, Share if you enjoyed this video. Connect with me - ● Instagram: 🤍 ● Facebook: 🤍 ● Twitter: 🤍 Vlogging Kit DJI OSMO Action Camera 🤍 Mobile Apple Iphone 12 Oppo Reno 6 ULANZI Camera Tripod, Mini Flexible Tripod Stand with Hidden Phone Holder w Cold Shoe Mount 🤍 BOYA by-MM1 Universal Cardiod Shotgun Microphone 🤍

Pune News | Four Members Of A Family Were Found Dead In Keshav Nagar Pune | English News

2409
16
0
00:03:54
14.01.2023

Pune News | Four Members Of A Family Were Found Dead In Keshav Nagar Pune | English News #BreakingNews | Four members of a family were found dead in #KeshavNagar, #Pune. Four members of a family, including a couple and their two children were found dead inside their house in Keshav Nagar area of Pune on Friday night. The deceased have been identified as Dipak Thote (55), his wife Indu (45), their son (24), and daughter (17), said a police officer from Mundhwa police station. #pune #suicide #englishnews

6 BHK Luxury Spanish Villa For Sale Mundhwa Pune | High End Villa Konark Riva Espaniol Keshav Nagar

13531
259
26
00:16:18
05.08.2022

A Massive 10,000 sq ft 2 level massive Spanish Villa is up for sale at Konark Riva Espaniol which is a gated villa community situated in Mundhwa, Pune. This villa is brand new and ready to move and available on a as-is where-is condition. Kitchen is furnished with white goods and no expenses have been spared into making the villa a modern gorgeous villa that you will be hard pressed to find even in a city like Pune which has many great mansions and villas. Spread over two levels with a beautiful spiral staircase taking one from one level to another, this villa will impress with it's sheer scale, grandeur, natural lighting, the beautiful layout and the sheer living space that is unparalleled in similar villas. There are also two separate terraces on the top floor which one can decorate the way one desires. Situated in Keshav Nagar, Mundhwa which is centrally located with easy access to all the top areas of Pune such as Koregaon Park and Viman nagar, this villa is an investment that will pay huge rewards in the future. Villa is available for sale as well as rental. For more info on this property visit here - 🤍 Call on +98206 07875 to view this villa. Follow us on Instagram: 🤍 Follow Ayush on Instagram: 🤍 Follow us on Facebook: 🤍 Follow us on LinkedIn: 🤍 Credits: Direction & Production: Gupta & Sen Creative Team, Mumbai Website: 🤍

Keshav Nagar Mundhwa Aerial View | Pune #Shorts

559
20
0
00:00:30
09.04.2022

Keshav Nagar is a suburb in Pune in proximity to the high-end residential localities such as Kharadi,Kalyani Nagar, Viman Nagar, Koregaon Park etc. Keshav Nagar also attracts people who are working in the IT sector, as it is close to some of the major IT parks like Magarpatta IT Park and EON IT Park. जर तुम्हाला व्हिडिओ आवडला असेल तर पुणे शॉर्ट्स चॅनलला LIKE आणि SUBSCRIBE करायला विसरू नका🙏 अगर आपको वीडियो पसंद आया हो तो Pune Shorts चैनल को लाइक और सब्सक्राइब करना न भूलें🙏 If you Love the video then don't forget to LIKE and SUBSCRIBE to Pune Shorts channel🙏 Through Pune Shorts, it is our endeavor to show you all the information related to the Pune City like showing different parts of the city, highlighting the merits of Pune city, showing the ongoing development in Pune city as well as providing the information about the Real Estate. It will be an effort to show you everything within 1-minute. #shorts

Kharadi Keshav Nagar Bridge | Keshav Nagar Mundhwa Bridge | PPP Basis | PMC Issues Tendor of Bridge

24595
847
105
00:06:23
09.08.2021

We covered current update on Kharadi Keshav Nagar Bridge in this video. We have continuously shown all the updates on Kharadi Keshav Nagar Bridge on our channel. SaudaGhar's constant endeavor is to bring to you all the real estate related news, so that your dream of buying a house can be correct and easy. Other Video on Keshav Nagar👉 🤍 Other Video on Kharadi👉 🤍 WhatsApp us for detailed discussion👉 🤍 For further assistance you may call us on: +91- 7030771234 Subscribe SuadaGhar for regular update👉 🤍 Video Chapters; 00:00 Intro Real estate sector in Pune has escalated by leaps and bounds in less than a decade. The cultural capital of Maharashtra has been growing significantly with the advent of IT sector, globalization and industrialization. Every year new buyers ingress the market seeking for property investments thus creating an evident demand, on the other hand developers come up with new and cutting-edge technology projects year after year to cater the supply thereby continuing the cycle. New property buyers are not only the natives but also the nonresidents who’ve been looking for investing in a potential location. While this may seem a big opportunity for the investors, it has also been a major challenge for them with an ever-growing swarm of scamsters. SaudaGhar is an initiative to educate the buyer in every possible aspect. We at SaudaGhar, have been constantly thriving to empower and acquaint the buyer to make a sound decision while investing in property by understanding their individual needs, purpose, emotions, feelings and risks behind getting a safe and secure investment. We understand that buying one’s dream home involves a lot of framework which varies with individual and personal liberty. Our sole aim is to guide you with a complete 360-degree analysis and unbiased review of the property, location, timely work completion, budget and legalities at your door step, virtually. Our digital platform provides you with the other side of the coin as well which may not be known to you as an end user. This will not just benefit the buyer with secure investments, cost savings but also ensure that the buyer is informed enough about the present scenario to make a right call. The decision for buying/ investing lies solely with the buyer, SaudaGhar abstains from promotion. Our only intention is to educate, guide, and consult you with your problems. We’ve been fortunate enough from our genuine and happy customers for bestowing their love and support throughout our journey. We are more than happy and content to serve and help you resolve your issues. SaudaGhar makes sure that each of our client’s/customer’s query and request has been resolved be it through our active video portal, other social media handles or through our in-person consultation services. Our dynamic and proficient team of professionals helps you with Investment management/portfolio (property) management/capital management/financial advisory/client strategy and consulting. For further assistance SaudaGhar also has an active and efficient ground support team which deals with preliminary and detailed survey for every location and provide you the ground reality and helping you with an end-to-end support. Be it from pre-booking to post-possession, be it pre-construction to post-occupancy, SaudaGhar is here to help you. Think Real Estate, Think SaudaGhar! #kharadi #keshavnagar #currentupdate - ℙ𝕝𝕖𝕒𝕤𝕖 𝕗𝕠𝕝𝕝𝕠𝕨 𝕊𝕒𝕦𝕕𝕒𝔾𝕙𝕒𝕣 𝕠𝕟 𝕠𝕥𝕙𝕖𝕣 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕡𝕝𝕒𝕥𝕗𝕠𝕣𝕞𝕤 𝕒𝕝𝕤𝕠; 𝕀𝕟𝕤𝕥𝕒𝕘𝕣𝕒𝕞👉 🤍 𝕋𝕨𝕚𝕥𝕥𝕖𝕣👉 🤍 𝕃𝕚𝕟𝕜𝕖𝕕𝕀𝕟👉 🤍 𝔽𝕒𝕔𝕖𝕓𝕠𝕠𝕜👉 🤍 𝕋𝕒𝕜𝕒𝕥𝕒𝕜👉 🤍 𝕎𝕖𝕓𝕤𝕚𝕥𝕖👉 🤍 𝔸𝕝𝕝 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕝𝕚𝕟𝕜𝕤👉 🤍

Keshav Nagar - Kharadi Bridge Update Sep 2022 Mundhwa - Kharadi Bridge #pune #shorts

11639
358
36
00:00:59
07.09.2022

Latest update of Kharadi-Keshav Nagar upcoming bridge | Ground view & Ariel view You can send us your query / concern 👉🏻 🤍 WhatsApp us for detailed discussion👉 🤍 For further assistance you may call us on: +91- 7030771234 Video Chapters; 00:00 Intro Real estate sector in Pune has escalated by leaps and bounds in less than a decade. The cultural capital of Maharashtra has been growing significantly with the advent of IT sector, globalization and industrialization. Every year new buyers ingress the market seeking for property investments thus creating an evident demand, on the other hand developers come up with new and cutting-edge technology projects year after year to cater the supply thereby continuing the cycle. New property buyers are not only the natives but also the nonresidents who’ve been looking for investing in a potential location. While this may seem a big opportunity for the investors, it has also been a major challenge for them with an ever-growing swarm of scamsters. SaudaGhar is an initiative to educate the buyer in every possible aspect. We at SaudaGhar, have been constantly thriving to empower and acquaint the buyer to make a sound decision while investing in property by understanding their individual needs, purpose, emotions, feelings and risks behind getting a safe and secure investment. We understand that buying one’s dream home involves a lot of framework which varies with individual and personal liberty. Our sole aim is to guide you with a complete 360-degree analysis and unbiased review of the property, location, timely work completion, budget and legalities at your door step, virtually. Our digital platform provides you with the other side of the coin as well which may not be known to you as an end user. This will not just benefit the buyer with secure investments, cost savings but also ensure that the buyer is informed enough about the present scenario to make a right call. The decision for buying/ investing lies solely with the buyer, SaudaGhar abstains from promotion. Our only intention is to educate, guide, and consult you with your problems. We’ve been fortunate enough from our genuine and happy customers for bestowing their love and support throughout our journey. We are more than happy and content to serve and help you resolve your issues. SaudaGhar makes sure that each of our client’s/customer’s query and request has been resolved be it through our active video portal, other social media handles or through our in-person consultation services. Our dynamic and proficient team of professionals helps you with Investment management/portfolio (property) management/capital management/financial advisory/client strategy and consulting. For further assistance SaudaGhar also has an active and efficient ground support team which deals with preliminary and detailed survey for every location and provide you the ground reality and helping you with an end-to-end support. Be it from pre-booking to post-possession, be it pre-construction to post-occupancy, SaudaGhar is here to help you. Think Real Estate, Think SaudaGhar! - ℙ𝕝𝕖𝕒𝕤𝕖 𝕗𝕠𝕝𝕝𝕠𝕨 𝕊𝕒𝕦𝕕𝕒𝔾𝕙𝕒𝕣 𝕠𝕟 𝕠𝕥𝕙𝕖𝕣 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕡𝕝𝕒𝕥𝕗𝕠𝕣𝕞𝕤 𝕒𝕝𝕤𝕠; 𝕀𝕟𝕤𝕥𝕒𝕘𝕣𝕒𝕞👉 🤍 𝕋𝕨𝕚𝕥𝕥𝕖𝕣👉 🤍 𝕃𝕚𝕟𝕜𝕖𝕕𝕀𝕟👉 🤍 𝔽𝕒𝕔𝕖𝕓𝕠𝕠𝕜👉 🤍 𝕋𝕒𝕜𝕒𝕥𝕒𝕜👉 🤍 𝕎𝕖𝕓𝕤𝕚𝕥𝕖👉 🤍 𝔸𝕝𝕝 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕝𝕚𝕟𝕜𝕤👉 🤍

Excellaa Tremont- Launching 2 BHK Flats In Keshav Nagar-Mundhwa.

7972
69
0
00:04:15
23.08.2021

DISCOVER THE MAGIC OF LIVING UP & ABOVE Excellaa Tremont - Exclusive 2 BHK Flats In Keshav Nagar-Mundhwa. Express Your Interest for the Most Unique Project With 30+ ROOF TOP AMENITIES in the Heart-of-EAST PUNE in terms of location at Keshav Nagar-Mundhwa. HIGHLIGHTS :- ✅ Sky Temperature Control Swimming Pool ✅ Sky Gym ✅ Sky Lounge ✅ Sky Walk ✅ Sky Library ✅ Sky Musical Garden ✅ Sky Co-Working Cubical’s ✅ Sky Garden ✅ Star Gazing ✅ EOI Amount 🤍 51000/- HURRY!! ITS NOW OR NEVER. WE ARE NOT HERE TO BE COMMON, WE ARE HERE TO BE INCREDIBLE. #Excellaa #Excellaatremont #2bhk #Pune #ComingSoon #KeshavNagar #Mundhwa.

Basil Mondale Keshav Nagar | 2 & 3 BHK Palatial Homes | Sample Flat | Price | Rhk Vlogs Official

13814
164
92
00:20:08
26.05.2022

Uber luxury residential project in an expansive open curated green space for the chosen few. Connecting with life, 2 and 3 Bedroom apartments are thoughtfully designed to nurture your heart and soul. USP of the project- 1.Lifestyle near the prime location 2. Picturesque neighborhood bounded by Mula-Mutha river 3. High-class living 4. Meticulously designed 5. Best-in-class facilities Details:- Project Size- 4 Acres Total Units- 500+ Units Total Bldgs- 5 High-rise Towers (A1, A2, A3,A4, & A5) No of Floors - 17 storeys (14 Habitable floors + 3 Level parkings) Launching Phase1- 300+ Units (A1, A2&A3) Recreational Space- More then 40% of the plot with all Modern Amenities Typology:- Exclusive Specious 2 & 3 BHK Only Budget Range 2 BHK 1. 702 sq.ft. 2. 713 sq.ft. 3. 751 sq.ft. 3 BHK 1. 938 sq.ft. 2. 957 sq.ft. 3. 992 sq.ft. #basilmondale #basilmondalekeshavnagar #2bhkflatsinkeshavnagar #3bhkflatsinkeshavnagar #3bhkinkeshavnagar #2bhkApartmentsforsaleinkeshavnagar #3bhkapartmentsforsaleinkeshavnagar #flatsinkeshavnagar #flatsnearmundhwa #2bhkinhinmundhwa #3bhkinhinmundhwa #luxuryhomesinmundhwa #ultraluxuryprojectinkeshavnagar #projectinmundhwa Thank you for watching and reading. Make sure to Like & Subscribe, and Share if you enjoyed this video. Connect with me - ● Instagram: 🤍 ● Facebook: 🤍 ● Twitter: 🤍 Vlogging Kit DJI OSMO Action Camera 🤍 Mobile Apple Iphone 12 Oppo Reno 6 ULANZI Camera Tripod, Mini Flexible Tripod Stand with Hidden Phone Holder w Cold Shoe Mount 🤍 BOYA by-MM1 Universal Cardiod Shotgun Microphone 🤍 Song: Luke Bergs & MBB - Poolside Music provided by Vlog No Copyright Music. Creative Commons - Attribution-ShareAlike 3.0 Unported Video Link: 🤍

2 BHK Flat for ReSale in Mundhwa Pune | 1 min from Old Orbis School | DMART Store outside society

5816
40
26
00:09:48
07.03.2022

2 BHK Flat for Sale in Mundhwa Pune | 1 min from Old Orbis School | DMART Store outside society Please note that this Property is still available for SALE I get number of phone calls each day and have to spend at leat 10-15 minutes on each call to understand customer requirements, to get OWNER Phone number please follow below steps 1) pay 100 Rs to UPI ID trekbookindia🤍ybl 2) Then whats app using following link with payment details click below link to what's app me 🤍 3) Then you will get direct property owner phone number for discussion = BUMPER OFFER HDFC, SBI, or any of home loan company = Home Loan processing fees 40% OFF on if home loans above 40L Home Loan processing fees 50% OFF on if home loans above 50L Home Loan processing fees 60% OFF on if home loans above 60L Home Loan processing fees 70% OFF on if home loans above 70L Home Loan processing fees 80% OFF on if home loans above 80L Home Loan processing fees 90% OFF on if home loans above 90L Home Loan processing fees 100% OFF on if home loans above 1Cr = Fill in below inquiry form 🤍 OR email us for details info🤍fintrustindia.in = My channel provides unbiased content, I purchase products to review and not for FREE or any promotions, this helps me expressing unbiased review of product. If you wish to help my channel financially to buy more products, then do use below links for buying You can HELP my channel = Get LOWEST quote for your car insurance simply click link below 🤍 Best Offers on Amazon affiliate link 🤍 SBI Bank Credit Card - NO Joining FEE 🤍 Citi Bank Credit Card - Cash back worth ₹1000 🤍 ICICI Bank Credit card - Best OFFER 🤍 = 33 Keshavkunj is premium society located near old orbis school. USP for this flat is nearness to school, which is 1 mon walkable distance from society. Also there is proposed DMART store at entrance of society. Address: Keshav Kunj, 33, near old orbis school, Keshav Nagar, Mundhwa, Pune, Maharashtra 411036 🤍 The flat is located in premium location in Mundhwa from where all things like Amanora town center, Magarpatta city, Noble hospital, Laxmi lawns, Chandan nagar, Victoria kids school, Radisson, Zensar, Inorbit mall, Phonix market city are located nearby this 33 Keshav kunj society. Flat is 2 BHK and recently painted by the first owner. All papers are clear and property is clear title without any loan. All taxes are paid and society charges are clear. So its a ready to buy and ready to move in flat in Mundhwa area. no broker, rent flats without broker, sale flats without broker, buy flats without broker, flat for sale in mundhwa pune, new flats in mundhwa pune, resale flats in mundhwa pune, 2bhk resale mundhwa, flats in mundhwa pune for rent, 1 bhk flat for sale in mundhwa pune, mundhwa property rates, mundhwa pune distance, new projects in mundhwa pune, 33 keshav kunj reviews, keshav kunj keshav nagar, 2 bhk in keshav nagar, 2 BHK Flats for Sale in Mundhwa Pune, 2 BHK Apartments for Sale in Mundhwa Pune, 2 BHK Flats for Sale in Mundhwa Pune,

Best Investment Properties in Pune || Godrej Infinity, Keshav Nagar || Rhk Vlogs Official

13533
87
21
00:16:00
28.01.2022

Godrej Infinity project is spread over a total area of 42.95 acres of land. It has 63% of open space. Godrej Infinity has a total of 16 towers. The construction is of 28 floors. An accommodation of 2684 units has been provided. Total Project Area: 42.95 Acres (173.81K sq.m.) | 63% Open Project Details: 16 Towers2684 Units 28 Floors Configurations: Apartment | 1, 2, 3 BHK Is it worth buying a house in #Pune now? Yes, the current time is good to buy a house in Pune. There are several reasons for this; 1. Presently, stamp duty in Pune is less till 31st March 2021. 2. The premium for the builder has come down by 50%. Due to this, the number of flats in every project is going to increase in the coming time. 3. Due to Covid_19, builders are providing good offers. 4. In the coming time, the area of the house would be less. पुणे, बैंगलोर और हैदराबाद को पीछे छोड़ते हुए पिछले 7-सालों में बना सबसे बेहतरीन #RealEstateMarket में। इस दौरान पुणे में 38% की बढ़ोत्तरी रही। वहीं बंगलौर और हैदराबाद में 20% का ग्रोथ रहा। #bestpropertiesinpune #bestinvestmentpropertiesinpune #godrejinfinitykeshavnagar #godrejinfinity #puneproperties #pune Thank you for watching and reading. Make sure to Like & Subscribe, Share if you enjoyed this video. Connect with me - ● Instagram: 🤍 ● Facebook: 🤍 ● Twitter: 🤍 Vlogging Kit DJI OSMO Action Camera 🤍 Mobile Apple Iphone 12 Oppo Reno 6 ULANZI Camera Tripod, Mini Flexible Tripod Stand with Hidden Phone Holder w Cold Shoe Mount 🤍 BOYA by-MM1 Universal Cardiod Shotgun Microphone 🤍 –––––––––––––––––––––––––––––– Life by Roa 🤍 Creative Commons — Attribution 3.0 Unported — CC BY 3.0 Free Download / Stream: 🤍 Music promoted by Audio Library 🤍 ––––––––––––––––––––––––––––––

Mundhwa Keshav Nagar, Pune New Launch Project Review | Mantra Mesmer (Codename Wonderland) | 2022

15244
267
40
00:07:14
16.09.2021

We have tried to show you through this video what is the current status of the newly launched project in Keshav Nagar. The name of the project is Mesmer. But you must have heard this project in the name of Mantra Codename Wonderland. Mantra Zirconia is the developer of this project. We have covered all the things of Keshav Nagar Mundhwa location. Which we have tried to show through many videos. If you have not seen these videos, we are giving its link below. Future of Keshav Nagar👉 🤍 Keshav Nagar-Kharadi Bridge👉 🤍 WhatsApp us for detailed discussion👉 🤍 For further assistance you may call us on: +91- 7030771234 Subscribe SuadaGhar for regular update: 🤍 Video Chapters; 00:00 Intro 00:55 Road Connectivity 02:38 Project Detail 03:31 Inventories & Pricing 05:05 Key Distances 06:10 Pros & Cons 06:55 The End Real estate sector in Pune has escalated by leaps and bounds in less than a decade. The cultural capital of Maharashtra has been growing significantly with the advent of IT sector, globalization and industrialization. Every year new buyers ingress the market seeking for property investments thus creating an evident demand, on the other hand developers come up with new and cutting-edge technology projects year after year to cater the supply thereby continuing the cycle. New property buyers are not only the natives but also the nonresidents who’ve been looking for investing in a potential location. While this may seem a big opportunity for the investors, it has also been a major challenge for them with an ever-growing swarm of scamsters. SaudaGhar is an initiative to educate the buyer in every possible aspect. We at SaudaGhar, have been constantly thriving to empower and acquaint the buyer to make a sound decision while investing in property by understanding their individual needs, purpose, emotions, feelings and risks behind getting a safe and secure investment. We understand that buying one’s dream home involves a lot of framework which varies with individual and personal liberty. Our sole aim is to guide you with a complete 360-degree analysis and unbiased review of the property, location, timely work completion, budget and legalities at your door step, virtually. Our digital platform provides you with the other side of the coin as well which may not be known to you as an end user. This will not just benefit the buyer with secure investments, cost savings but also ensure that the buyer is informed enough about the present scenario to make a right call. The decision for buying/ investing lies solely with the buyer, SaudaGhar abstains from promotion. Our only intention is to educate, guide, and consult you with your problems. We’ve been fortunate enough from our genuine and happy customers for bestowing their love and support throughout our journey. We are more than happy and content to serve and help you resolve your issues. SaudaGhar makes sure that each of our client’s/customer’s query and request has been resolved be it through our active video portal, other social media handles or through our in-person consultation services. Our dynamic and proficient team of professionals helps you with Investment management/portfolio (property) management/capital management/financial advisory/client strategy and consulting. For further assistance SaudaGhar also has an active and efficient ground support team which deals with preliminary and detailed survey for every location and provide you the ground reality and helping you with an end-to-end support. Be it from pre-booking to post-possession, be it pre-construction to post-occupancy, SaudaGhar is here to help you. Think Real Estate, Think SaudaGhar! - ℙ𝕝𝕖𝕒𝕤𝕖 𝕗𝕠𝕝𝕝𝕠𝕨 𝕊𝕒𝕦𝕕𝕒𝔾𝕙𝕒𝕣 𝕠𝕟 𝕠𝕥𝕙𝕖𝕣 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕡𝕝𝕒𝕥𝕗𝕠𝕣𝕞𝕤 𝕒𝕝𝕤𝕠; 𝕀𝕟𝕤𝕥𝕒𝕘𝕣𝕒𝕞👉 🤍 𝕋𝕨𝕚𝕥𝕥𝕖𝕣👉 🤍 𝕃𝕚𝕟𝕜𝕖𝕕𝕀𝕟👉 🤍 𝔽𝕒𝕔𝕖𝕓𝕠𝕠𝕜👉 🤍 𝕋𝕒𝕜𝕒𝕥𝕒𝕜👉 🤍 𝕎𝕖𝕓𝕤𝕚𝕥𝕖👉 🤍 𝔸𝕝𝕝 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕝𝕚𝕟𝕜𝕤👉 🤍

2&3 BHK Luxury Homes @Keshav Nagar, Mundhwa

99
0
0
00:00:27
04.01.2023

Shree Venkatesh Buildcon group brings yet another Luxurious Homes project Graffiti Elan. 2&3 BHK Luxury homes at affordable prices. For more information Visit our website: 🤍venkateshbuildcon.com or call: ‎+91 95131 67006 for Pick up & Drop service to visit the site location. #punebuilders #luxuryhomes #propertyinvestor #construction #readyhomes

3 BHK ROW HOUSE FOR SALE IN KESHAV NAGAR MUNDHWA PUNE | 1.45 CR | CALL 9518725599

1213
7
4
00:02:51
21.11.2021

3 BHK ROW HOUSE FOR SALE IN KESHAV NAGAR MUNDHWA PUNE | 1.45 CR | CALL 9518725599 4 Options ...3bhk big size Row house Sale ... New Project ... Mundhawa Keshav Nagar Vastu Compliant 💯 Plot Areas 1720 Garden Area 630 Carpet 2230 Super build up 3080 1.45 cr package deal Nigotible 👍 #Row_House_In,Pune, #Row_House_For_Sale_In_Pune #Row_House_For_Sale_In_Keshav_Nagar_Pune #3_bhk_villa_in_pune_for_sell, #House_Flats_Plots #house_flats_plots Row House in Pune under 50 lakhs, New row House in Pune, Row house projects in Pune, Row house for sale near me, Row House in Pune under 20 Lakh, Independent House for sale in pune olx, Low budget row houses in Pune, Row Houses in Pune under 30 lakhs, Row house in Pune price, Bungalow in Pune, Row House near me, Independent House for sale in Pune, Luxury bungalow for sale in Pune, Row Houses in Pune for 40 lakhs, Marvel Bounty resale, Unika Hadapsar Pune, Builders in Hadapsar Pune, 3 BHK for sale in Handewadi Road

The new landmark of Mundhwa

1963
11
0
00:03:38
23.04.2022

The new landmark of Mundhwa has finally arrived, redefining the Pune skyline. Relish the high life in lofty and serene homes. Explore Basil Mondale in Keshav Nagar, Mundhwa, one of the most premium projects in Pune with well-crafted 2 and 3 BHK homes. Fulfill your definition of comfort with doorstep facilities, luxury amenities, and many more things. Experience luxurious living soaked in country charm. Visit us to know more about your dream home. 📞Call us on: +91-8090069003 🌐 Website: 🤍 Email Id - info🤍basilmondale.com Follow us on:- Facebook: 🤍 Instagram: 🤍 LinkedIn: 🤍 Twitter: 🤍 #basilmondale #basilmondalekeshavnagar #2bhkflatsinkeshavnagar #3bhkflatsinkeshavnagar #3bhkinkeshavnagar #2bhkApartmentsforsaleinkeshavnagar #3bhkapartmentsforsaleinkeshavnagar #flatsinkeshavnagar #flatsnearmundhwa #2bhkinhinmundhwa #3bhkinhinmundhwa #luxuryhomesinmundhwa #ultraluxuryprojectinkeshavnagar #projectinmundhwa

Vertical Oriana Keshav Nagar | Resale and Rental Flat | Sample Flat | Location | Rhk Vlogs Official

7222
139
45
00:11:12
28.03.2022

Vertical Oriana Keshav Nagar Review and Details. #verticaloriana #keshavnagar #realestate You may also watch: Living a grand life involves having enough space for your life to unfold. That means living in a place where you get spacious homes inside and ample open spaces outside. That’s exactly what we offer at Vertical Oriana. But having space is one thing and smartly using that space is another. Vertical Oriana is thoughtfully conceptualised to offer spectacular structural design, utmost functionality as well as optimum efficiency of resources. About Vertical Oriana Favourably located in Keshav Nagar, Mundhwa in Pune, Vertical Oriana is a meticulously planned project. It covers an area of 3 Acre giving enough green space to residents. The property comprises of 222 units which are enclosed within a peaceful environment. The project is smartly constructed, and all the units are Under Construction. The project comprises of 4 well-executed towers which offer a nice view of the surroundings. The launch date of this beautiful project is 01 May 2015. Its official date of possession is 01 March 2022. Vertical Oriana's commencement certificate has been granted. In addition to this, the occupancy certificate not granted. Vertical Oriana is a high-quality yet affordable residential project by Vertical Infra. You can enjoy the best facilities and amenities at Vertical Oriana, such as Meditation Area, Club House, Swimming Pool, Gymnasium, AEROBICS ROOM, Event Space & Amphitheatre, Kids Play Area, Library And Business Centre. The site's complete address is SR. No. 7, Near Renuka Mata Mandir, Keshav Nagar, Mundhwa, Pune-411036. 411036 is the area pincode under which this project falls. Enjoy the luxury of living with all modern conveniences in Vertical Oriana. Vertical Oriana Address SR. No. 7, Near Renuka Mata Mandir, Keshav Nagar, Mundhwa, Pune-411036, 411036, is the complete address of Vertical Oriana Project Advantage Education Orbis School - 1.6 kms Amanora School – 3.7 kms Pawar Public School – 4 kms Eon Gyanankur School – 4.2 kms Magarpatta City Public School – 4.3 kms Nirmala Convent – 4.6 kms Serra International Pre-School – 5.1 kms St. Arnold’s (Wadgaonsheri) – 5.2 kms Lexicon – 8.0 kms Wadia College – 8 kms Dastur School – 8.1 kms St. Helena’s – 8.4 kms St. Mira’s College – 8.7 kms The Bishop’s School – 9 kms St. Vincent (Ghorpadi) – 9.1 kms Healthcare Columbia Asia Hospital – 2.5 kms Rakshak Hospital – 3.7 kms Sahyadri Hospital – 5 kms Noble Hospital – 6.3 kms Inlax Budhrani Hospital – 7 kms Ruby Hall Clinic – 8.2 kms Jehangir Hospital – 8.2 kms Workspace Zensar IT Park – 3.9 kms Magarpatta IT Park – 4.2 kms World Trade Center – 5.4 kms EON IT Park – 5.7 kms Cerebrum IT Park – 6.4 kms Hadapsar Industrial Estate – 6.9 kms SP Infocity – 8.4 kms Entertainment Hotspots : Seasons Mall – 3 kms Amanora Town Centre – 3.5 kms Reliance Mart – 3.5 kms Nitesh Hub – 4.4 kms Gold Big Cinemas – 5.9 kms Inorbit Mall – 6.8 kms Phoenix Marketcity - 7.7 kms SGS Mall – 8.4 kms Important Distance Hadapsar Railway Station - 2.6 kms Pune Railway Station - 9.2 kms Pune Airport - 9.3 kms USP: Reflection Pool with Dancing Fountain. Designer Welcome Plaza. Designer Pathway. Steady appreciation year on year Thank you for watching and reading. Make sure to Like & Subscribe, Share if you enjoyed this video. Connect with me - ● Instagram: 🤍 ● Facebook: 🤍 ● Twitter: 🤍 Vlogging Kit DJI OSMO Action Camera 🤍 Mobile Apple Iphone 12 Oppo Reno 6 ULANZI Camera Tripod, Mini Flexible Tripod Stand with Hidden Phone Holder w Cold Shoe Mount 🤍 BOYA by-MM1 Universal Cardiod Shotgun Microphone 🤍 Music by Luke Bergs: ▶Youtube: 🤍 ▶Spotify: 🤍 ▶Soundcloud: 🤍 ▶Facebook: 🤍 ▶Instragram: 🤍

Keshav Nagar और Mundhwa की सबसे बड़ी समस्या | Pune Roads | Pune Real Estate

10277
66
8
00:02:29
28.01.2019

Mundhwa Road is worse because of this narrow road Near Mundhwa Chowk. #MundhwaChowk #PMC #PMRDA For more further assistance you may Connect us on : +91- 7030771234 #RealEstate #Investment follow us on other social media: Facebook: 🤍 Twitter: 🤍 InstaGram: 🤍 Google+: 🤍 Website: 🤍SaudaGhar.com

Excellaa- Exclusive 2 BHK Flats Coming Soon In Keshav Nagar, Mundhwa.

4065
8
0
00:00:50
13.07.2021

#Coming Soon Excellaa- Exclusive 2 BHK Flats Coming Soon In Keshav Nagar, Mundhwa. ✅ High Rise Towers ✅ Access from Various Area like Nagar Rd, Hadapsar, EON IT Park, Magarpatta. ✅ Higher Return on Investment & Better Rentals ✅ More Space More Savings. Most Iconic project of Pune coming soon in Keshav Nagar,Mundhwa, Pune . Express your interest now.

Indapandant House For Sale In Keshav Nagar Mundhawa pune 25lack

734
11
2
00:03:34
05.10.2022

Indapandant House For Sale In Keshav Nagar Mundhawa pune 25lack Plot Area 500sqft Ground floor 1bhk And 1st floor Double room Corporation limit Call 9518725599 Whatsapp 9765638907 Youtube channal : House Flats Plots which is into Estate services. We provide for Sell and Rental, Residencial and Commercial properties, lands and flats after varifications and RERA certification to our customers . We provide Rental Flats (1BHK,2BHK,3BHK,Row Houses,Bunglows) in branded and populer projects. We satisfy our customers by meeting their queries in all aspects as we understand their requirements in complete manner from our years of experiance. Our customers consult with us for investing in right project and locations, also with land dealing in Local Area in and around Pune. We always welcome our customers to have honest conversation regarding Lands, Flats, and related legal issues to our Agency. Call Now : 9518725599

PGD PINNACLE KESHAV NAGAR MUNDHWA PUNE || 1 BHK FLAT ON RENT ||

493
14
17
00:01:34
15.06.2020

DREAM POINT REALTORS, is located in Keshav Nagar, Mundhawa, Pune ; which is into Estate services. We provide for Sell and Rental, Residencial and Commercial properties, lands and flats after varifications and RERA certification to our customers . We provide Rental Flats (1BHK,2BHK,3BHK,Row Houses,Bunglows) in branded and populer projects. We satisfy our customers by meeting their queries in all aspects as we understand their requirements in complete manner from our years of experiance. Our customers consult with us for investing in right project and locations, also with land dealing in Local Area in and around Pune. We always welcome our customers to have honest conversation regarding Lands, Flats, and related legal issues to our Agency. Call : 9518725599 PGD PINNACLE KESHAV NAGAR MUNDHWA PUNE || 1 BHK FLAT ON RENT || PGD Pinnacle Keshav nagar Pune #1BHK Flat In #Keshav Nagar Mundhwa Pune | Rent 15000/- Deposite 3months Our Rental Flat Page Available on Facebook please Like Our Facebook Page 👇👇 🤍 #house_plots_flats 1 BHK FLAT IN KESHAV NAGAR MUNDHWA 1 BHK FLAT IN MUNDHWA PUNE 1 BHK FLAT ON RENT IN PUNE 1 BHK FLAT IN PUNE RENTAL FLAT IN KESHAV NAGAR MUNDHWA PUNE PROPERTY DEALER IN KESHAV NAGAR PUNE 1 BHK APARTMENT IN KESHAV NAGAR MUNDHWA PUNE 1 BHK FLAT IN PGD PINNACLE KESHAV NAGAR MUNDHWA Keshav nagar's all projects Keshav nagar ke sare projects #keshavnagar'sallprojects #allprojectsinkeshavnagarmundhwapune #Keshavnagarkesareprojects #1BHKFLATONRENTINKESHAVNAGAR #RENTALFLATINKESHAVNAGARMUNDHWA #1BHKAPARTMENTINKESHAVNAGARMUNDHWAPUNE #1BHKFLATONRENTKESHAVNAGAR #1BHKFLATINPGDPINNACLEKESHAVNAGARMUNDHWAPUNE #1BHKFLATINKESHAVNAGARMUNDHWAPUNE #1BHKFLATINPUNE #FLATINPUNE #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats #House_Plots_Flats Copyright Disclaimer under Section 107 of the copyright act 1976, allowance is made for fair use for purposes such as criticism, comment, news reporting, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favour of fair use.

2 BHK Home Interior Design in Keshav nagar, Mundhwa,Pune by #AdiInterior

1367
44
3
00:03:35
22.09.2020

Interior Design in Pune 2 BHK Home Interior Design in Keshav nagar, Mundhwa,Pune of Mr. Dilip Chaudhari Connect With Me - Gmail - adi.interior342🤍gmail.com Contact No - 9766500342/ 8600166188 (Deepak Pardeshi) Digital Card - 🤍 Track:JPB - High [NCS Release] 🤍 🤍 🤍 🤍 Music provided by NoCopyrightSounds Music promoted by Audio Library 🤍 Disfigure - Blank [NCS Release] ▽ Connect with NCS Facebook 🤍 Twitch 🤍 Twitter 🤍 Spotify 🤍 SoundCloud 🤍 Goo+ 🤍 Instagram 🤍 Follow Disfigure: 🤍 🤍 🤍 #adiinterior #interior #interiordesign #furniture #modular kitchen #youtube #interiordecor #homeinterior #renovation #urban Music Provided by: NoCopyrightSound

K CITY | 2 & 3 BHK | KESHAV NAGAR MUNDHWA | NEMI ASSOCIATES

4202
25
4
00:15:14
05.08.2021

#kcity #nemiassociates #keshavnagar2&3bhk NEMI ASSOCIATES PROVIDING FINANCIAL AND REAL ESTATE SERVICE'S WE ARE AUTHORISED RERA REGISTERED C P THIS IS K CITY PROJECT IN KESHAV MAGAR MUNDHWA PUNE WITH BEST AMENITIES 2BHK & 3 BHK FLATS IF INTERESTED IN THIS PROPERTY PLEASE CALL BELOW NUMBER OR WHATSAPP This is K City Project. Located in Keshav Nagar. Presenting KCITY Spread across 4 acres of land, located at great location. The location will give you excellent connectivity to so many important locations. 11 Buildings divided into 2 clusters. 3 level car parking + 13 floors of residences. 14 storey building. ROOFTOP Amenities. (20 + Amenities for all age groups.) Possession in Dec 2023 'K' is not just a name it's a Brand ! IF YOU ARE SEARCHING GOOD PROPERTY IN YOUR BUDGET YOU CAN CONTACT WITH US FOR MORE DETAILS PLEASE CALL ME OR WHATSAPP 9604314189

Goodwill Crescent Keshav Nagar | 2 BHK Actual Flat Tour | Choice Group Pune

2590
63
32
00:05:21
19.08.2022

Goodwill Crescent Keshav Nagar 2 BHK Sample flat tour along with Choice Group Pune Review overview, plans, pricing For Goodwill Crescent details like - - Pros &Cons - Unboxing / Sample Flat Videos - 3D Viewing - Payment Schedule etc... Visit Goodwill Crescent Housiey Page - 🤍 Download E-Brochure : 🤍 Download PriceSheet : 🤍 Choice Goodwill Project Overview Goodwill Crescent will be constructed on 4.5 acres of land parcel,4 towers with B+14 floors having 2 BHK , premium residences. Choice Goodwill Crescent location Project is located near keshav nagar in mundhwa, Pune with - Manjari Road - 350 m Mundhwa-Kharadi - 1.7 km Reliance Smart - 4.1 km Choice Group Keshav Nagar Amenities First is Internal amenities - Vitrified tiles, Granite Kitchen, Earthquake resistance, Video door, Digital lock, DG backup, Solar Heater, SS railing & many more Goodwill Crescent Keshav Nagar Pune External Amenities Project has 30+ luxurious amenities with likes of - Swimming Pool Indoor Games Club house Party lawn Gymnasium & Many More Goodwill Crescent Pune Parking - Project has only one type of car parking facility i.a. Ground Choice Goodwill Crescent Possession - Rera Possession - December 2024 Target Possession - June 2023 Carpet Area & Floor Plan Goodwill Crescent Mundhwa project has 2 BHK premium residences with - 2 BHK - 655 & 760 sqft Goodwill Crescent Floor Plan Tower floor plans will have 6 flats,2 lifts & 2 staircases on each floor Maintenance - Choice Goodwill Crescent Pune Project maintenance varies with the configuration and the carpet area which are as follows- 2 BHK - 4000 Per Month Goodwill Crescent sample flat is ready to view at the site. Goodwill Crescent at Keshav Nagar Pune price & its details can be found in the price section & Choice Goodwill Crescent Mundhwa brochure can be downloaded from the link mentioned below. Project has been praised by the home buyers & Choice Group Mundhwa review is 4 out of 5 from over all the clients who have visited the site. If you have any queries related to the project like brochure, pricing, payment schemes or want to do a site visit, Clients can click on the link mentioned in the description, Our NRI Clients can also connect us on the same link. At last if you like this video, & to watch more such new launch Project videos, Subscribe to our channel Housiey

Keshav Nagar, Mundwa to Kharadi Bridge में क्या है Budget का नया पेंच? Pune News 2021

11817
307
30
00:03:27
25.12.2021

In this video you will get to see the new update of the bridge between Keshav Nagar Mundwa and Kharadi. जानें इस ब्रिज में बजट को लेकर क्या है नया पेंच? WhatsApp us for detailed discussion👉 🤍 For further assistance you may call us on: +91- 7030771234 Subscribe SuadaGhar for regular update: 🤍 खबर की औपचारिक पुष्टि ना होने के कारण इस वीडियो में Mantri Vantage के बारे में जो खबर दिखाई गई थी उसे हमें हटाना पड़ा। इस पर यदि हमें आगे कुछ औपचारिक अपडेट मिलेगा तो आप लोगों के समक्ष नए वीडियो के माध्यम से पूरी जानकारी जरूर ले आएंगे। आपसभी को असुविधा हुई इसके लिए हमें खेद है। Real estate sector in Pune has escalated by leaps and bounds in less than a decade. The cultural capital of Maharashtra has been growing significantly with the advent of IT sector, globalization and industrialization. Every year new buyers ingress the market seeking for property investments thus creating an evident demand, on the other hand developers come up with new and cutting-edge technology projects year after year to cater the supply thereby continuing the cycle. New property buyers are not only the natives but also the nonresidents who’ve been looking for investing in a potential location. While this may seem a big opportunity for the investors, it has also been a major challenge for them with an ever-growing swarm of scamsters. SaudaGhar is an initiative to educate the buyer in every possible aspect. We at SaudaGhar, have been constantly thriving to empower and acquaint the buyer to make a sound decision while investing in property by understanding their individual needs, purpose, emotions, feelings and risks behind getting a safe and secure investment. We understand that buying one’s dream home involves a lot of framework which varies with individual and personal liberty. Our sole aim is to guide you with a complete 360-degree analysis and unbiased review of the property, location, timely work completion, budget and legalities at your door step, virtually. Our digital platform provides you with the other side of the coin as well which may not be known to you as an end user. This will not just benefit the buyer with secure investments, cost savings but also ensure that the buyer is informed enough about the present scenario to make a right call. The decision for buying/ investing lies solely with the buyer, SaudaGhar abstains from promotion. Our only intention is to educate, guide, and consult you with your problems. We’ve been fortunate enough from our genuine and happy customers for bestowing their love and support throughout our journey. We are more than happy and content to serve and help you resolve your issues. SaudaGhar makes sure that each of our client’s/customer’s query and request has been resolved be it through our active video portal, other social media handles or through our in-person consultation services. Our dynamic and proficient team of professionals helps you with Investment management/portfolio (property) management/capital management/financial advisory/client strategy and consulting. For further assistance SaudaGhar also has an active and efficient ground support team which deals with preliminary and detailed survey for every location and provide you the ground reality and helping you with an end-to-end support. Be it from pre-booking to post-possession, be it pre-construction to post-occupancy, SaudaGhar is here to help you. Think Real Estate, Think SaudaGhar! - ℙ𝕝𝕖𝕒𝕤𝕖 𝕗𝕠𝕝𝕝𝕠𝕨 𝕊𝕒𝕦𝕕𝕒𝔾𝕙𝕒𝕣 𝕠𝕟 𝕠𝕥𝕙𝕖𝕣 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕡𝕝𝕒𝕥𝕗𝕠𝕣𝕞𝕤 𝕒𝕝𝕤𝕠; 𝕀𝕟𝕤𝕥𝕒𝕘𝕣𝕒𝕞👉 🤍 𝕋𝕨𝕚𝕥𝕥𝕖𝕣👉 🤍 𝕃𝕚𝕟𝕜𝕖𝕕𝕀𝕟👉 🤍 𝔽𝕒𝕔𝕖𝕓𝕠𝕠𝕜👉 🤍 𝕋𝕒𝕜𝕒𝕥𝕒𝕜👉 🤍 𝕎𝕖𝕓𝕤𝕚𝕥𝕖👉 🤍 𝔸𝕝𝕝 𝕤𝕠𝕔𝕚𝕒𝕝 𝕞𝕖𝕕𝕚𝕒 𝕝𝕚𝕟𝕜𝕤👉 🤍

Kharadi Keshav Nagar Bridge | हर जानकारी आपतक पहुँचाना जरूरी | Real Estate News | Mula-Mutha River

18078
270
22
00:06:02
02.01.2020

Watch this critical condition of Mula-Mutha River where the untreated water being let out in the river has become a major concern. Subscribe SuadaGhar for regular update: 🤍 For further assistance you may Call us: +91- 7030771234 Whatsapp: 🤍 #punenewslive #kharadi #keshavnagar Follow us on other social media: Facebook: 🤍 Twitter: 🤍 Instagram: 🤍 Website: 🤍SaudaGhar.com LinkedIn: 🤍

Most Famous Anna dosa of keshav nagar pune |#shorts

7417
217
1
00:00:52
10.09.2021

Most Traditional Dosa || super crispy || He sells more than 1000 dosa daily🙊 #punestreetfood Location-Opposite orbis school keshavnagar mundhwa pune maharashtra.

Basil Mondale Keshav Nagar Sample Flat | 3 BHK Sample Flat Tour | Basil Mondale Mundhwa

2403
48
25
00:06:44
13.08.2022

Basil Mondale Keshav Nagar Sample Flat of 3 BHK Tour along with Basil Mondale Mundhwa Project Review overview, plans, pricing Download E-Brochure : 🤍 Download PriceSheet : 🤍 Basil Mondale Keshav Nagar Project Overview Basil Mondale will be constructed on 4 acres of land parcel, 5 towers with 2B+G+14 floors having 2 BHK , 3 BHK premium residences. Basil Mondale Pune location Project is located near manjari road in Mundhwa, Pune with - Mundhwa-Kharadi Road - 1.7 km Amanora Park Chowk - 2.6 km Reliance Mall - 4.2 km Basil Module 2 & 3 BHK Premium Homes Mundhwa Amenities First is Internal amenities - Vitrified tiles, Granite Kitchen, Solar water connection, RCC structure, DG backup, CPVC plumbing, Aluminum powder coating 3 track aluminum sliding window & many more Basil Mondale External Amenities Project has 25+ luxurious amenities with likes of - Multipurpose court Multipurpose lawn Musical Garden Club House Children's Play area & Many More Basil Mondale Sample Flat Parking - Project has two types of car parking facilities which are as follows Ground & Basement Basil Mondale Possession - Rera Possession - December 2025 Target Possession - December 2024 Carpet Area & Floor Plan Basil Mondale Keshav Nagar Pune has 2 BHK, 3 BHK premium residences with - 2 BHK - 700 to 751 sqft 3 BHK - 938 to 992 sqft Basil Mondale floor plan Tower floor plans will have 8 flats,2 lifts & 2 staircases on each floor Maintenance - Basil Group Pune Project maintenance varies with the configuration and the carpet area which are as follows- 2 BHK - (3000 - 3500) Per month 3 BHK - (4000 - 4500) Per month Basil Mondale sample flat is ready to view at the site. Basil Mondale price & its details can be found in the price section & Basil Mondale Mundhwa brochure can be downloaded from the link mentioned below. Project has been praised by the home buyers & Basil Group Mundhwa review is 4 out of 5 from over all the clients who have visited the site. If you have any queries related to the project like brochure, pricing, payment schemes or want to do a site visit, Clients can click on the link mentioned in the description, Our NRI Clients can also connect us on the same link. At last if you like this video, & to watch more such new launch Project videos, Subscribe to our channel Housiey

Nivasa Elevia keshav Nagar | Mundhwa, Pune | 2 BHK Sample Flat tour | Costsheet & Ebrochure link👇

1677
17
3
00:01:46
18.11.2021

Call : +918805711111 | Nivasa Elevia keshav Nagar | Mundhwa, Pune | 2 bhk Sample Flat tour | Reviews | Costsheet & Ebrochure link below👇 Download E-brochure : 🤍 Download Costsheet : 🤍 Call PROJECT Call HEMIKA PROPERTY : +918805711111 Message HEMIKA PROPERTY on WhatsApp: 🤍 Nivasa Elevia Sample Flat: 0:00 About Project 0:05 Entrance Lobby : 3.7' X 4.9' 0:13 Living/Dining Room : 10.0' X 16.0' 0:24 Balcony : 10' X 5.11' 0:34 Kitchen : 8' X 9.9' 0:46 Utility : 3.5' X 9.9' 0:51 Bedroom : 9.0' X 11.0' 1:01 Common Bathroom : 6.6' X 4.6' 1:09 Master Bedroom: 10' X 13.0' 1:24 Attach Bathroom : 7.6' X 4.6' Nivasa Elevia is residential project developed by Nivasa Group located in Keshav Nagar, Mundhwa, Pune. This project provide 2, 2.5 & 3 BHK aparment with starting area from 752 Sq.ft To 1019 Sq.ft Carpet Area at affordable cost. Location Benifit :- Mundhwa is one of the main residential cum industrial sectors situated in Pune, Maharashtra. Keshav Nagar connects to the rest of the city via Magarpatta main Road and Ghopardi Road. Pune Airport is located at a short drive of 20 mins. The area has several residential complexes in the area. The place is one of the best growing places and lies adjacent to numerous IT and BPO companies. Mundhwa is connected to central Pune through the Pune-Solapur Highway. The nearest airport is the Pune international airport that connects the area with several national and international places of importance. Mula Mutha River flows by the area. Close To - Manjari Road, Magarpatta Road & Keshav Nagar Nearby Landmarks Columbia Asia Hospital The Orbis School Gold Plaza Stella Maris High School State Bank ATM Manjari Budruk Metro Station INOX Movie Theater Maitri Restaurant & Om Sai Enterprises Petrol Pump AMENITIES Swimming Pool Designer Club House Multipurpose / Basketball Practice Court Children’s Play Area with rubber matting & Indoor Games Jogging Track Gymnasium Meditation Area Party Lawn With Stage Barbeque Area Ample Seating & Conversation Areas Amphitheatre Ground floor Society office Provision for MNGL gas pipeline Projector along with screen for club house SPECIFICATIONS STRUCTURE:- Earthquake resistant R.C.C Frame Structure KITCHEN:- Dado tiles up-to 2' above the platform. Black Granite platform with S.S. Sink. Provision for Water purifier. Provision for Washing Machine and washing place in Dry Balcony DOORS:- Main Door - Laminated flush Door & safety lock. Other Doors - Laminated Flush doors. FLOORING :- Good quality Vitrified flooring in all room Anti-skid ceramic tiles for all Toilets & Bathrooms TERRACES:- Glass Railings & Anti-Skid Tiles. THANK YOU FOR WATCHING Regards, HEMIKA PROPERTY. MUSIC CREDITS: Sunset Beach by Scandinavianz 🤍 Creative Commons — Attribution 3.0 Unported — CC BY 3.0 Free Download / Stream: 🤍 Music promoted by Audio Library 🤍 nivasa elevia, nivasa elevia keshav nagar, nivasa, nivasa Gr, nivasa construction, nivasa Realty, nivasa udaan, nivasa group, nivasa udaan phase 2, 3 BHK Apartments in Keshav Nagar Pune, keshav nagar, keshav nagar pune, keshav nagar pune properties, nivasa elevia keshav nagar mundhwa, mantra insignia keshav nagar, florida riverwalk keshav nagar, godrej rejuve keshav nagar, godrej infinity keshav nagar, keshav nagar kharadi bridge, unique legacy keshav nagar, keshav nagar flats, keshav nagar pune future, mundhwa future development #Nivasagroup #Nivasaelevia #Nivasaudan

Heavy Traffic Jam on Mundhwa Chowk🚘🚦Keshav Nagar Fully Chocked 🚗🚙 #pune #traffic #short

5689
122
19
00:00:30
12.07.2022

Keshav Nagar पूरी तरीक़े से traffic से भर गया है। तेज बारिश के चलते Keshav Nagar - Kharadi का एक मात्र छोटा ब्रिज भी बंद हो गया है, इसी वजह से सारी traffic एक तरफ़ से ही आ पा रही है।

Назад
Что ищут прямо сейчас на
keshav nagar mundhwa creepre george karl droid david dong PL FoneArena SAMARQANDLIKLAR afghan squall line в хорошем качестве Mallika) я паштєт і армія аудіокнига военная психология kafi rp ikco genshin coop domain ps4 danur 3 sunyaruri same beef video recipe