Gir cow

Gir cow смотреть последние обновления за сегодня на .

👌गुजरात की #गीरगाय!!👍#Gircow Yadav Dairy Farm👍Chhotu..(Only What'sAap 9511592301)

13513
226
11
00:09:14
27.01.2023

👌गुजरात की #गीरगाय!!👍#Gircow Yadav Dairy Farm👍Chhotu..(Only What'sAap 9511592301) shree Yadav Dairy Farm Village.Patan th.kishangarh Jill.ajmer state.rajsthan owner chotu Yadav 9511592301 सभी गौधन प्रेमीयो को मेरा नमस्कार मै आपका दोस्त विकास मे हमेशा आपके लिए एक से बढ़कर एक गीर गाय का विडियो डालता रहता हु, तो आप अच्छी नस्ल की गायें खरीदने के लिए हमसे जुड सकते है, हमारे चैनल को Subscribe कर सकते है, जय हिंद जय गौमाता ।।। 👉All India Transport Available 👉Transportation Charge 14 Rupees Per Kilometers Up Down +Toll Up Down हमारे पास हमेशा गीर गाय मिलती है 🙏🙏🙏🙏🙏 👉Note:-(Gir Cow Any Time Available My Farm) 🥰Thanks For Watching Video For Cow😍 #shreeyadavdairyfarmpatan #gircow #gircowmilking #milkingcow #gircowmilking #gujratwaligircow #gujratcowgir #cowdileavery #cowbronfemalecalf #shreeyadavdairyfarmpatankishangarhajmerrajsthan #yadavdairyfarmpatan #chhotu_yadav_patan #girgay #Patan #cow #cowfarm #cowmilking #cowlaver #cowvideos #cowsong ##cowdance #cowcartoon #cowfunney #gircowforsellpatan #gircowforsellkishangarh #gircowfarm #gircowbreed #gircowdairyfarm #gircowforsell #gircowfarming #girgay #gircowfarmingujrat #gircowgujrat Quaries: gir cow Farm in Gujrat gir cow Dairy Farm gir cow price in India gir cow milk gir cow milk benefits gir cow ghee gir cow for Sell gir cow status gir cow Gujrat gir cow calf gir cow milking gir cow Farm gir cow Farm in Gujrat gir cow for Sell gir cow price in India gir cow milk benefits #गुजरातकीगीरगायकाविडिओ #गुजरातकीगीरगायकीकिमत #गुजरातकीगीरगाय #गुजरातकीगीरगायदिखाईये #गुजरातकीओरीजनलगिरगाय #गुजरातकीगीरनस्लकीगाय #गुजरातगीरगायफार्म #गीरगायराजस्थान #गीरगायपरहोनेवालीधोकाधडीसेबचे #गीरगाय #गीरगायदुधव्वसाय #गीरनस्लकिगाय

👌गुजरात कि #गीरगाय!! #Gircow Yadav Dairy Farm Chhotu...(Only What'sAap 9511592301)

5080401
27859
591
00:06:27
31.05.2022

👌गुजरात कि #गीरगाय!! #Gircow Yadav Dairy Farm Chhotu...(Only What'sAap 9928787671) shree Yadav Dairy Farm Village.Patan th.kishangarh Jill.ajmer state.rajsthan owner chotu Yadav 9511592301 सभी गौधन प्रेमीयो को मेरा नमस्कार मै आपका दोस्त विकास मे हमेशा आपके लिए एक से बढ़कर एक गीर गाय का विडियो डालता रहता हु, तो आप अच्छी नस्ल की गायें खरीदने के लिए हमसे जुड सकते है, हमारे चैनल को Subscribe कर सकते है, जय हिंद जय गौमाता ।।। All India Transport Available Transportation Charge 14 Rupees Per Kilometers Up Down +Toll Up Down Gir Cow Milk.... Gir Cow Price...... 10 12 ltr 50000 - 60000 14 16 60000 80000 Heavy Cow Rate Your Diamand हमारे पास हमेशा गीर गाय मिलती है 🙏🙏🙏🙏🙏 🥰Thanks For Watching Video For Cow😍 #shreeyadavdairyfarmpatan #gircow #gircowmilking #milkingcow #gircowmilking #cowdairy #Gircowseller Quaries: gir cow Farm in Gujrat gir cow Dairy Farm gir cow price in India gir cow milk gir cow milk benefits gir cow ghee gir cow for Sell gir cow status

100% Pure (Jasdan Bloodline) Gir Cow Available For Sell 9511592301

3564
116
9
00:04:54
27.01.2023

100% Pure (Jasdan Bloodline) Gir Cow Available For Sell 9511592301 shree Yadav Dairy Farm Village.Patan th.kishangarh Jill.ajmer state.rajsthan owner chotu Yadav 9511592301 सभी गौधन प्रेमीयो को मेरा नमस्कार मै आपका दोस्त विकास मे हमेशा आपके लिए एक से बढ़कर एक गीर गाय का विडियो डालता रहता हु, तो आप अच्छी नस्ल की गायें खरीदने के लिए हमसे जुड सकते है, हमारे चैनल को Subscribe कर सकते है, जय हिंद जय गौमाता ।।। 👉All India Transport Available 👉Transportation Charge 14 Rupees Per Kilometers Up Down +Toll Up Down हमारे पास हमेशा गीर गाय मिलती है 🙏🙏🙏🙏🙏 👉Note:-(Gir Cow Any Time Available My Farm) 🥰Thanks For Watching Video For Cow😍 #shreeyadavdairyfarmpatan #gircow #gircowmilking #milkingcow #gircowmilking #gujratwaligircow #gujratcowgir #cowdileavery #cowbronfemalecalf #shreeyadavdairyfarmpatankishangarhajmerrajsthan #yadavdairyfarmpatan #chhotu_yadav_patan #girgay #Patan #cow #cowfarm #cowmilking #cowlaver #cowvideos #cowsong ##cowdance #cowcartoon #cowfunney #gircowforsellpatan #gircowforsellkishangarh #gircowfarm #gircowbreed #gircowdairyfarm #gircowforsell #gircowfarming #girgay #gircowfarmingujrat #gircowgujrat Quaries: gir cow Farm in Gujrat gir cow Dairy Farm gir cow price in India gir cow milk gir cow milk benefits gir cow ghee gir cow for Sell gir cow status gir cow Gujrat gir cow calf gir cow milking gir cow Farm gir cow Farm in Gujrat gir cow for Sell gir cow price in India gir cow milk benefits #गुजरातकीगीरगायकाविडिओ #गुजरातकीगीरगायकीकिमत #गुजरातकीगीरगाय #गुजरातकीगीरगायदिखाईये #गुजरातकीओरीजनलगिरगाय #गुजरातकीगीरनस्लकीगाय #गुजरातगीरगायफार्म #गीरगायराजस्थान #गीरगायपरहोनेवालीधोकाधडीसेबचे #गीरगाय #गीरगायदुधव्वसाय #गीरनस्लकिगाय

gir cow female calf 4 teeth 1st lactation 18 liter 9983954391

1621703
12119
267
00:06:56
07.01.2022

👇इस गाय के दूध निकलते विडिओ देख न के लिए नीचे दिए लिंक क्लिक करे और विडिओ देखे👇 🤍 नीच 👇 दिये लिंक को ओपन कर के आप गाय के अलग अलग विडिओ देख लो यह सब गाय सेल के लिए हे 🤍 Aravali Dairy Farm bajeda bala ji mandir ke paas Jogiyo ka nada Arai rod Kishangarh jila district (ajmer) ....Rajasthan... . pin code 305801 akram pathan 9829854391 Aamir pathan 9414745465 Aravali dairy farm (aamir pathan) 🤍

gir cow 2nd lactation pregnant delivery after 5 days 18 liter par day top quality gir 9414745465

2539
106
8
00:05:14
25.01.2023

#aravalidairyfarm aravali dairy farm Aamir pathan #agricultureaamirpathangircow #gircowghee #gircowseller #kishangarhajmerrajasthangircow #gircowmilking #gircowfarmingujarat #gircow #aravalidairyfarm #agriculture #kishangarhajmerrajasthangircow #gircow #pathangircowrajasthan #ajmergircow

Highest Milking Gir Cow Breed ll Brazilian Gyr Cows ll Indian Gir Cows

364959
2123
37
00:08:02
29.12.2022

Note: This video credit goes to its owners. I am not the owner of these video clips . In any case if you are the owner of these videos kindly message us at tariqsultan126🤍gmail.com we will follow your instructions as soon as we receive the mail. alpine goat diet world biggest goat biggest bakra,alpine goat breed,girlando cow breed,indian gir cow breed,jersey cows,alpine goat breed in india,gyr cow,alpine goat buck,alpine goat baby,high milking cows,alpine goat fight,alpine goat in kerala,alpine goat price in pakistan,cow,qurbanunalpine goat farm in pakistan,alpine goat breeding season goat farming,gir cow,cow videos,cow milking, buffalo videos, cow, buffalo, heifer, jersey cow, gir cow, holstein friesian cow, dairy cattle, sahiwal cow, holstein cow, sahiwal cattle, hf cow, cow farm, dairy cow, milk cow, cow meat, jersey milk, desi cow, cow and calf, gir cow price, cow brush, cow feed, sahiwal cow price, cow grass, cow mandi, jersey cow price, american cow, beef cow, milk cows, hf cow price, desi cow milk, highest milk producing cows, a2 desi cow milk, cow market, best cow, fat in cow milk, desi cow price, fat in buffalo milk, buffalo fight, buffalo farm, buffalo cartoon, buffaloes, buffalo farming in pakistan, buffalo farm in pakistan, buffalo animal, buffalo artificial insemination, a buffalo kills a lion, a buffalo versus a lion, a buffalo versus a bull, a buffalo sound, buffalo buffalo, buffalo baby, buffalo business in pakistan, buffalo breeds, buffalo birth, buffalo business, buffalo baby birth, buffalo cow, buffalo dairy farm, buffalo dairy farm in pakistan, buffalo delivery, buffalo delivery video, buffalo diseases and treatment in urdu, buffalo eating grass, buffalo eating food, buffalo exercise, buffalo eye infection, buffalo ear infection, buffalo for sale, buffalo for sale in pakistan, buffalo fight with lion, buffalo farm house, buffalo giving birth, buffalo give birth baby, girlando cow, jersey cows, american brahman, buffalo movie, buffalo mandi in punjab, buffalo nili ravi, buffalo not eating food, buffalo national geographic, buffalo on installments, buffalo or cow, buffalo online, #dairy_farming #buffalo_farming #cow_farming #nili_ravi_buffalo #world_biggest_udder_buffalo #livestock #buffalo_dairy_farm buffalo farm, buffalo farm in pakistan, a buffalo giving birth, buffalo business, buffalo business in pakistan, buffalo breeding in pakistan, buffalo birth, buffalo bull in pakistan, buffalo dairy farm, buffalo delivery, buffalo dairy farm in pakistan, buffalo delivery video, buffalo gas problem, buffalo heat, dairy milk, dairy farm, dairy farming in pakistan, dairy queen, dairy and agri, dairy america milk powder, a dairy farm, dairy business, dairy business in pakistan, dairy business ideas in pakistan, dairy business talks, dairy buffalo farm, dairy cow, dairy cream, dairy cow mandi 2021, dairy cattle farm, dairy cow sale purchase, dairy cattle, dairy decorating ideas easy, dairy equipment, dairy expert, e diary channel, dairy farm business in pakistan, dairy farm shed design, dairy farming business, dairy farm shed design pakistan, dairy farm banane ka tarika, dairy farm cow, dairy goat, dairy guide, dairy girl, dairy group, dairy goat farming, dairy goat farming in usa, dairy hub, dairy hindi, diary hacks, dairy herd management, h f cow dairy farm, dairy in pakistan, diary ideas, dairy industry in pakistan, dairy information, dairy info j k dairy farm, j k dairy, dairy king lahore, dairy king milk, dairy ka business, dairy kaise start kare, dairy kaise shuru kare, dairy ka business kaise start kare, daily pakistan, dairy pure milk, dairy queen tiktok, arjun murrah bull, murrah bull, murrah dairy farm, murrah bull semen, super murrah buffalo, super murrah bull, world biggest udder buffalo, buffalo farm, punjab murrah dairy buffalo farm, buffalo, indian murrah buffalo, water buffalo, jat buffalo farm, sardar bull, world biggest bull, semen production unit qadirabad, strong bloodline bull, bull semen, murrah bulk semen, dairy farm buffalo matting, sunny leon, Modi bull, Lakshmi dairy farm, pakistan biggest buffalo farm, holstein friesian cattle, holstein friesian cows in australia, holstein friesian badshah, holstein friesian cow milking, holstein friesian cows for sale in pakistan, holstein friesian cow farm in pakistan, holstein friesian cows farm, holstein friesian gay, holstein friesian guru, holstein friesian cow in bangladesh, holstein friesian cow in india, holstein friesian cows in kenya, holstein friesian jersey, holstein friesian cow jogan, holstein friesian kühe, holstein friesian cow price in india, pure holstein friesian cow, #dairy_farming #modern_dairy_farming #modern_agriculture #agricultural_machines #amazing_technology #advance_technology #modern_technolog

गुजरात की No.1 Woman (महिला) Gir Cow Breeder | Must Watch | 👍

681677
7263
376
00:22:52
11.07.2022

ऐसी गौसेवा की भावना आज तक नही देखी। दीदी से बात करने हेतु सम्पर्क आराधन थवाईत Mo. 8980260712, 9374722007 Toll Free No. - 18002120018 Email I’d - scgg.bharat🤍gmail.com Website - 🤍scgg.bharat🤍wordpress.com श्री चैतन्य गिर गौशाला Behind shaligram Mil opp. hanuman temple kanij mahij road garam- kanij Near barejadi Dist- kheda ahemdabad gujrat

Ultimate experience of Gir Cow Gaushala | gir cow breeding farm | pure ghee and A2 milk Bussiness.

883320
6148
349
00:25:09
22.08.2022

#gircow #cowbreeding #indianfood #cowfarm #pureghee #a2milk #pinkcity Taking some time out of the busy life of the city, going to nature and living that moment is sometimes very relaxing, One such place is in Jaipur, where there is a very beautiful farm of more than 80 Gir cows, where you can go You can experience how milking and organic farming are done by a Beautiful couple, if you want to purchase organic dairy products and organic vegetables from there so you can 😊👍 Handchurned Gir Cow A2 Ghee: ₹3000/litre Gir Cow A2 Milk: ₹100/litre Seasonal farm fresh organic veggies: Rates vary depending on the season. *Website:* 🤍kinayafarms.com If you want to visit this farm plz call- Mr Vibhor-76654 66657 Kinaya Organic Farms and Life 🤍 Also if you wanna ask me anything then please let me know in the comment section. If you like rajasthani block print shirts go through this link & buy - 🤍 Follow me on Instagram - 🤍 Facebook-🤍 About: We mainly covers the surroundings of Jaipur and various places in Rajasthan (India) and aspires to cover the diverse India and the diversity around the world by our insightfull content for our viewers and readers. We generally cover places, food tastes of cities, culture, monuments and other interesting facts and interests. Host - Ashish Wadhwani, is one of the better growing influencers from the Rajasthan region and looking forward to serving his subscribers better than before in his every video upload on youtube and blog insight on the website.

गुजरात की #गीरगाय !!👍#Gircow Yadav Dairy Farm Chhotu.. (Only what's aap 9511592301)

1720172
13897
194
00:09:33
22.10.2022

गुजरात की #गीरगाय !!👍#Gircow Yadav Dairy Farm Chhotu.. (Only what's aap 9511592301) shree Yadav Dairy Farm Village.Patan th.kishangarh Jill.ajmer state.rajsthan owner chotu Yadav 9511592301 सभी गौधन प्रेमीयो को मेरा नमस्कार मै आपका दोस्त विकास मे हमेशा आपके लिए एक से बढ़कर एक गीर गाय का विडियो डालता रहता हु, तो आप अच्छी नस्ल की गायें खरीदने के लिए हमसे जुड सकते है, हमारे चैनल को Subscribe कर सकते है, जय हिंद जय गौमाता ।।। 👉All India Transport Available 👉Transportation Charge 14 Rupees Per Kilometers Up Down +Toll Up Down हमारे पास हमेशा गीर गाय मिलती है 🙏🙏🙏🙏🙏 👉Note:-(Gir Cow Any Time Available My Farm) 🥰Thanks For Watching Video For Cow😍 #shreeyadavdairyfarmpatan #gircow #gircowmilking #milkingcow #gircowmilking #gujratwaligircow #gujratcowgir #cowdileavery #cowbronfemalecalf #shreeyadavdairyfarmpatankishangarhajmerrajsthan #yadavdairyfarmpatan #chhotu_yadav_patan #girgay #Patan #cow #cowfarm #cowmilking #cowlaver #cowvideos #cowsong ##cowdance #cowcartoon #cowfunney #gircowforsellpatan #gircowforsellkishangarh #gircowfarm #gircowbreed #gircowdairyfarm #gircowforsell #gircowfarming #girgay #gircowfarmingujrat #gircowgujrat Quaries: gir cow Farm in Gujrat gir cow Dairy Farm gir cow price in India gir cow milk gir cow milk benefits gir cow ghee gir cow for Sell gir cow status gir cow Gujrat gir cow calf gir cow milking gir cow Farm gir cow Farm in Gujrat gir cow for Sell gir cow price in India gir cow milk benefits #गुजरातकीगीरगायकाविडिओ #गुजरातकीगीरगायकीकिमत #गुजरातकीगीरगाय #गुजरातकीगीरगायदिखाईये #गुजरातकीओरीजनलगिरगाय #गुजरातकीगीरनस्लकीगाय #गुजरातगीरगायफार्म #गीरगायराजस्थान #गीरगायपरहोनेवालीधोकाधडीसेबचे #गीरगाय #गीरगायदुधव्वसाय #गीरनस्लकिगाय

गिर गाय मंडी धुळे 24 जानेवारी 2023 | gir cow market in dhule Maharashtra | धुळे गिर गाय बाजार#dhule

15815
259
20
00:08:59
24.01.2023

गिर गाय मंडी धुळे 24 जानेवारी 2023 | gir cow market in dhule Maharashtra | धुळे गिर गाय बाजार#dhule#akashjadhavdhule #dhulegirgaybajar 🤍khandeshifarmerakash #gircow #gircowforsale #gircowfarmingujarat #gircrosscowfarming #dairyfarming #dairymilk #kankrejcowdeliverylive

20L भुवनेश्वरी पीठ गोंडल ब्लडलाइन की गिर गाय gir cow top milking top breed Uttar Pradesh 9983954391

692833
2658
209
00:18:44
07.12.2022

#aravalidairyfarm aravali dairy farm Aamir pathan #agricultureaamirpathangircow #gircowghee #gircowseller #kishangarhajmerrajasthangircow #gircowmilking #gircowfarmingujarat #gircow #aravalidairyfarm #agriculture #kishangarhajmerrajasthangircow #gircow #pathangircowrajasthan #ajmergircow

Gir Cow Dairy Farming: पशुपालकों के लिए फायदेमंद गिर गाय, सालाना कमा सकते हैं इतने लाख का मुनाफा

607
13
1
00:05:32
22.01.2023

Gir Cow Dairy Farming: पशुपालकों के लिए फायदेमंद गिर गाय, सालाना कमा सकते हैं इतने लाख का मुनाफा देश के ग्रामीण क्षेत्रों में पशुपालन आय का सबसे बड़ा स्रोत बनता जा रहा है. इनमें गाय पालन का चलन सबसे ज्यादा है. गाय की गिर नस्ल का पालन कर अच्छा मुनाफा कमा सकते हैं. इन नस्ल की गायों में दूध उत्पादन की क्षमता अन्य नस्ल की गायों के मुकाबले ज्यादा होती है. गिर नस्ल की गाय के पालन से आप सालाना लाखों का मुनाफा कमा सकते हैं. #annadata #agriculture #farming #cowfarms #latestnews #RajasthanNews #news18rajasthan Live News | Rajasthan News in Hindi, राजस्थान समाचार | LIVE Rajasthan News | राजस्थान की बड़ी खबरें | Latest Hindi News | News18 Rajasthan Live Updates | news 18 live | hindi news | latest news | news 18 | news 18 hindi | hindi samachar | n18oc_agriculture rajasthan news live, rajasthan news today, rajasthan news18, rajasthan news samachar,rajasthan news aaj ka samachar, live rajasthan, rajasthan samachar, rajasthan latest news #RajasthanLiveNews #LiveRajasthanNews #RajasthanSamachar #News18Rajasthan #Liverajasthan News18 Rajasthan में देखिये राजस्थान से जुडी सभी ख़बरें सबसे पहले News18 पर । Subscribe to our channel and don't forget to keep the bell icon on News18 Rajasthan is one of the country's leading news channel and is now also available Live on YouTube. The channel offers a ground level detailed coverage from Rajasthan. Subscribe to News18 Rajasthan to watch all breaking news and Live Coverage with latest videos added every hour. Please visit our news18rajasthan.com for latest opinions and detailed news coverage. Subscribe to our channel for latest news updates: 🤍 Like Us: 🤍 Follow Us: 🤍 Our Website: 🤍

25 L gir cow aravali dairy farm 9983954391

697638
25225
65
00:00:16
08.08.2022

दिये लिंक को ओपन कर के आप गाय के अलग अलग विडिओ देख लो यह सब गाय सेल के लिए हे 🤍 Aravali Dairy Farm bajeda bala ji mandir ke paas Jogiyo ka nada Arai rod Kishangarh jila district (ajmer) ....Rajasthan... . pin code 305801 akram pathan 9829854391 Aamir pathan 9414745465 Aravali dairy farm (aamir pathan) 🤍

#gir cow

86026
5098
8
00:00:07
21.11.2022

Super gir cow Gujarat

21580103
69226
221
00:00:15
08.07.2019

Jay Gau mata 🐂🐂🐂🐂🐂🐂 🔴આવા અવનવા 🐂ગીર ગાયો ના વિડિયો જોવા માટે અમારી ચેનલ gir cow gujarat ને Subscribe કરો અને બાજુ માં આપેલી ઘંટડી 🔔 ને. દબાવો એટલે અમારા વિડિયો ની જાણ થાય તમને સૌથી પહેલા.. 🔶 Likes share and #subscribeNow to Gujarati 🐂🐂🐂🐂🐂🐂 🔴Also see the video of the new cows Subscribe to our channel gir cow gujarat and the bell provided in the side 🔔 Press, so our video will be informed first of all .. 🔶 Likes share and #subscribeNow Content cover:- Dystocia in cow Amazing gir cow lnt meeting (साड) or super gir (गाय) Rajasthan arawli dairy farm sell gir cow 9414745465 Live village life with Om & family गुजरात की गिर गाय | Pure breed Gir cow from Gujarat गिर गाय का डेयरी फार्म || गिर गाय जो 50 लीटर दूध देती है || Gir cow with 50 litre Milk daily SHREE RAJMOTI GIR GAUSHALA KODINAR 30 litre milk lactation 3 calf drinking milk from 1 cow Lalo (Gir Calf) Drinking 10 litre milk Gondal Gir Cow 1st in Milk Yield Competetion "laxmi" Gujarat Milk Champion 2018 Gir cow matching New video 2018 first time gir cow meeting kaise pata Super gir cow lnt metting (साड) Bansi Gir Gaushala Ahmedabad GUJARAT'S PRIDE GIR COW AT SAM'S DAIRY FARM यहाँ से खरीदें गिर गाय | 17 Liter + Live Milking Gir Cow 🤍 Aryaman Gir Gaushala Rajasthan Arawli Gir 9414745465 गीर गाय 50 लीटर दूध देती है || Gir cow milk 50 litres || By Farmer choice 1 lactation gir cow sell 9587971879 India's best Gir cow bull TOKHAR. Best gir bull in India. Gir cow Modi का गायों को लेकर बड़ा फैसला, Gujarat में बनाएंगे Gir cow sanctuary DESI COWS, Sahiwal, Gir, Red Sindhi & Hariyana cows are available for buyers- 🤍 KHURANA DAIRY Rohtak देसी गिर गाय पालन करने से पहले अंत तक देखे। Gir cow Hi tech dairy farm in india Rajasthan arawli sell gir cow 9414745465 GIR COW excellent milking Gir.9725930794.gir.gay.levesh....गीर औरीजनल गूजरात..जय.गौव माता L.20+ Rajasthan arawli dairy farm sell gir cow 9414745465 Ajmer Rajasthan gir cow sell 9587971879 👍 25 Year old Gir Bull- ARJUN NANDI 🤍Gir Gau Jatan Sansthan, Gondal, Rajkot. (94081 40328) Gir Cow : Benefits of Gir Cow over other Cows - गिर गाय की विशेषताएं Indian Gir Cow - daily milk production 50+ ltr Rajasthan arawli dairy farm sell gir cow 9414745465 किसान कैसे ज्यादा दूध वाली देसी गाय तैयार कर सकते है? How prepare milch cow like Brazil gir गीर गाय खरीदना चाहते है तो यह जरूर जाने | Gir Cow - Must know before you buy 18 गोत्र वाली गिर गाय :- गोपाल सुतरिया जी की अद्भुत गोशाला 18 lines of Gir cows Gaushala Gir cow from Maharashtra Gir Cow Love Her Newborn Calf इससे बढ़िया नही है कोई Business. -HF गायों को छोड़कर अब GIR गायो का Pure A2 दूध पिलाते है Jodhpur में। Gir gai (Gir cow) GIR COW MILK CAPACITY IS HIGH || Shelar Gir Cow Farm Koregaon | Satara | Shelar Farms GIR COW IN BRAZIL !! कैसे करें गिर गाय की पहचान | कहाँ मिलेगी गिर गाय | Gir Cow Full Information Intro - Shree Gir Gau Krushi Jatan Sansthan गिर - होल्स्टीन गाय प्रतियोगिता = पुष्कर मेला Great Gir & Holstein Cow Show & Contest- Pushkar Fair The Golden Cow of India | Swarna kapila gir cow from Gujarat Searching Gir Cow for Sale in Gujarat? | Know 7 Tips Before You Buy Gir Cow for Dairy Farming देसी गिर गाय डेयरी फार्म बिकाऊ है | For Sale: Desi Gir Cow 🤍Dairy Farm in India Hindi. Farming guruji Gir Cow | Where to Buy | Right Price | How to Select | Join Online Program Indian Gir Cow - Daily milk production 25+ Ltr. Jafrabadi Buffalo and Gir Cow in Khodal Gaushala Farm | जाफराबादी भैंसे शानदार | Jafarabadi buffalo Gado leiteiro de leite máximo | Best collection of Lildi type of Gir cow from Gujarat gir cow sell ke liye ready 9511592301.gir cow 120 रूपए लीटर गिर गाय का दूध || असीम रावत का गिर डेयरी फार्म || Hetha Gir Cow Dairy Farm Rajasthan arawli dairy farm sell gir cow 9414745465 यहाँ से गई थी गिर ब्राज़ील | Pure Gir cows at Swami Narayan Temple BAPS Gaushala Anant singh ka Buffalo,gir cow,horse Sonpur Mela bihar Rajasthan arawli dairy farm sell gir cow 9414745465 1st location Gir Cow Breeding and Care ગીર ગાયનું સંવર્ધન અને જતન World famous Gir cow farm | গির গাভীর জাত উন্নয়ন খামারে ৫৬ লিটার দুধ হয় | একসাথে দুজনে দু

Gir Cow Grazing Green Grass on Hill !!!

5150
351
27
00:04:09
22.10.2022

✅ Get Traditional Home Remedies for Cattle – Hindi – English – Gujarati Book: 🤍 Now watch the beauty of a cow grazing green grass on hill which indeed a most beautiful scene in my life. In the time of Lord Sri Krishna, Goddess gau matas were grazing on hill of Goverdan same way myself so much excited share those movement with you. Join Our Gir Cow or Gau Palan Training Program ✅ Gau Palan Training: 🤍 ✅ Vedic Bilona Machine | Vedic Wooden Bilona Machine | Vedic Bilona Ghee Making Machine 🤍 ✅ Mobile App: 🤍 #cowgrazing #BestDairyPractice

గిర్ ఆవుపాలతో ఇన్ని లాభాలా | Health Benefits of Gir Cow Milk & Ghee | Eagle Media Works

17873
433
31
00:11:17
04.01.2022

Watch గిర్ ఆవుపాలతో ఇన్ని లాభాలా | Health Benefits of Gir Cow Milk & Ghee | Eagle Media Works #Gyr #Gir #Bapanna For More Interesting videos Subscribe us on ►🤍 Join & Become a Member of Eagle Media Works ☛🤍 Follow my social media! ☛ Facebook : 🤍 ☛ Eagle Media Blogger : 🤍 ☛ Follow Us on Twitter : 🤍 ☛ Visit our Official Website : 🤍 ► Sports Page : 🤍 Like & Subscribe & Comment Thank You all for watching ! Disclaimer: It doesn't feel good to have a disclaimer in every video but this is how the world is right now. All videos are for awareness purposes and use them wisely. Any video may have a slight inaccuracy, please take a decision based on your research and use. This video is not forcing anything on you. We are trying to provide a perfect, valid, specific, detailed information, but we are not a licensed professional, so make sure with your professional consultant in case you need. All the content published in our Channel is our own creativity.

GIR COWS IN TAMIL | வட நாட்டு மாடுகள் நாட்டு மாடுகளா ? | INDIAN COW | INFOTECH MEDIA TAMIL

10725
182
7
00:07:14
18.10.2021

Detailed video about Gir/Gyr cows. Gir is named after Gir forest, the geographical area of origin of the breed. This is a world-renowned breed known for its tolerance to stress conditions. Having faced scarcity for a numbers of years, it has the capacity of yielding more milk with less feeding and is resistant to various tropical diseases. The animals are of red color. Horns are peculiarly curved. Milk quality A2 beta casein protein, For more information's please watch the video. #gircowsintamil #countrybreedcows #infotechmedia #naatumaadugal

Gir cow in gujrat

7246822
149356
317
00:00:13
10.04.2020

Gir cow

15 वर्षांचा कृष्णा सांभाळतोय गीर गाईंची गोशाळा | Top Quality Gir cow farm in maharashtra

104145
1604
96
00:26:19
08.12.2022

Krushna Ghule - 8989099777 🤍 Channel शी संपर्क करण्यासाठी For Business Enquiry- farmingbabaji🤍gmail.com #gircowfarm #dairyfarming #gircow In this video 1 desi cow dairy farm 2 desi cow for sale 3 desi cow ghee 4 desi cow farming in india 5 gir cow price in india 6 gir cow farm in maharashtra 7 gir cow farm,gir gay dairy farm 8 gir gai palan,gir gai chi mahiti 9 sahiwal gai dairy farm 10 sahiwal gai palan #gaypalan #desicowfarm Topics related this 1 gay palan business marathi 2 gay palan sarkari yojana 3 gay palan maharashtra 4 gay palan dairy 5 gay palan shed 6 gay palan business maharashtra 7 gir cow milk benefits 8 desi cow ghee benefits 9 sahiwal cow farm in maharashtra 10 गोमुत्राचे फायदे 11 देशी गाईचे महत्व

Gir cow and new born gir cow calf

10133843
154951
108
00:00:16
10.06.2021

Hariba A2 Gir Cow Ghee

47533
73
3
00:00:46
31.03.2021

The Hariba Dairy Farm began its unending pursuit of quality in the year 2018. It's driven by the vision and the dynamism of the founder, Shri Vinubhai Sutariya. He envisioned to make people understand the strength of Bharat’s ancient Vedic culture and how it can be incorporated in our daily eating habits. The Veda mentions thus, “We must regard the 'Cow' as our Mother and serve her to the best of our abilities, keeping her happy in every way”. These high values are presented in the way our cows are nurtured and Ghee is made at Hariba Farms. Our process of Ghee making is not just about making a product but it talks about the entire journey in a Vedic manner. To order your Hariba Gir Cow Ghee,⁠ Call us : +91 86750 70809⁠ Order : 🤍haribadairyfarm.com

Highly Milking Biggest Udder Gir Cow Breed 60 Litters Milk per day world Record | Gir Cow

8774
95
5
00:05:21
11.11.2022

Highly Milking Biggest Udder Gir Cow Breed 60 Litters Milk per day world Record | Gir Cow #cow_milk #cow #gircow #cowfarmbihar #buffalo_farming #cattle_farming #dairy_farming #gircowforsale 🤍 m.facebook.com/sabir.cheena.9?_rdr# 🤍 🤍 🤍

gir bull ho gir cow gujrat

20365
1123
0
00:00:09
17.12.2022

୧୩୦ ଟଙ୍କା ଲିଟର ଗାଈ କ୍ଷୀର , ଓଡ଼ିଶାରେ ଗୀର ଗାଈ ପାଳନ ( Start Gir cow farming in Odisha ).

192305
4256
252
00:13:13
30.10.2020

In this video, we have discussed about Gir cow farming in odisha. Gir is one of the best milkers among indigenous cattle. The breed is also known as “Bhodali”, “Desan”, “Gujarati”, “Kathiawari”, “Sorthi”, and “Surati”. The breeding tract of the breed includes Amreli, Bhavnagar, Junagadh, and Rajkot districts of Gujarat and is named after the Gir forest, the geographical area of origin of the breed. Bullocks can drag heavy loads on all kinds of soils, be it sandy, black or rocky. This is a world-renowned breed known for its tolerance to stress conditions. Having faced scarcity for a number of years, it has the capacity for yielding more milk with less feeding and is resistant to various tropical diseases. Due to their special qualities, animals of this breed have been imported by countries like Brazil, USA, Venezuela and Mexico, and are being bred there successfully. #gir #cow #farming #odisha - M.M Sharma - 9937022269 - eFarming App ବିଷୟରେ ଜାଣିବା ପାଇଁ ତଳେ ଦିଆ ଯାଇଥିବା ଲିଙ୍କକୁ କ୍ଲିକ କରି ଭିଡିଓ ଟି ଦେଖନ୍ତୁ:- 🤍 App ଟି install କରିବା ପାଇଁ ତଳେ ଦିଆ ଯାଇଥିବା ଲିଙ୍କକୁ କ୍ଲିକ କରନ୍ତୁ:- 🤍 - - mobile we use :- 🤍 camera we use :- 🤍 microphone we use :- 🤍 camera tripod we use :- 🤍 selfie stick we use :- 🤍 light stand we use :- 🤍 LED light we use :- 🤍 green screen we use :- 🤍 - - ତଳେ ଦିଆଯାଇଥିବା link କୁ click କରନ୍ତୁ ଏବଂ ଆମରI Facebook Page କୁ like କରନ୍ତୁ । 🤍 ତଳେ ଦିଆଯାଇଥିବା link କୁ click କରନ୍ତୁ ଏବଂ ଆମକୁ Instagram ରେ follow କରନ୍ତୁ । 🤍 ତଳେ ଦିଆଯାଇଥିବା link କୁ click କରନ୍ତୁ ଏବଂ ଆମକୁ Twitter ରେ follow କରନ୍ତୁ । 🤍 .......... ଧନ୍ୟବାଦ ..........

Ma Beti Ki Jodi Pure Bhavnagar Line Gir Cow For Sale 👍 Vill. Damnagar Dist. Amreli Gujarat Farm Talk

6436
173
8
00:03:42
13.11.2022

Ma Beti Ki Jodi Pure Bhavnagar Line Gir Cow For Sale 👍 Vill. Damnagar Dist. Amreli Gujarat Farm Talk

gir cow 1st lactation aravali dairy farm 16 liter par day milk 9983954391

781205
5105
74
00:08:00
02.05.2022

दिये लिंक को ओपन कर के आप गाय के अलग अलग विडिओ देख लो यह सब गाय सेल के लिए हे is cow ka acche se video dhekne ke liye niche click kre 👇👇👇👇👇👇 🤍 🤍 Aravali Dairy Farm bajeda bala ji mandir ke paas Jogiyo ka nada Arai rod Kishangarh jila district (ajmer) ....Rajasthan... . pin code 305801 akram pathan 9829854391 Aamir pathan 9414745465 Aravali dairy farm (aamir pathan) 🤍 Like and subscribe my YouTube channel #gircow #Aravalidairyfarm #21literpardaygircow #highmilkinggircow #100%puregircowandcalf #girfemalecalf #Rajasthangircow #A2milkdesicowgir #pathangircowrajasthan #cowfarmcalffarm

gir cow

2053
128
0
00:00:10
29.10.2022

A2 Gir Cow Milk, the age-old energy drink

2145
29
0
00:00:37
06.07.2022

A2 Gir Cow Milk is collected from A2 Gir cows that feed on nutritionally rich fodder grown organically at our farms. We make sure we do not deprive the calf's rights to its mother's milk & it has been fed in the right amount before we collect the milk. Milk is collected using German milking technology which is completely pain-free. Here's the complete milk collection process from our farm.

Gir Cow #short #youtube#shorts #cute #desi #gir #farming #cow#agriculture//@Gir Cow Gujarat

9094
223
0
00:00:08
25.10.2022

#short #youtube #gir #Desi Cow #Cow #farming #Desi #desi Gir Cow farm in Gujarat #Gir cow #gir #Desi Cow #Cow #farming #Desi #desi Gir Cow farm in Gujarat #Gir cow #gujarat #dairy #Gujarat dairy Farm #punjab #Punjab dairy Farm #Indian dairy Farm #ejjukibusinessideas #Farming Leader #tractor #harvester #agriculture #Gir Cow Lover #BHUTAVAD COW BREEDING #Gir Cow grazing Grass #Pyari gau mata #short #youtube #gir #Desi Cow #Cow #farming #Desi #desi Gir Cow farm in Gujarat #Gir cow #gir #Desi Cow #Cow #Kgf songs #martial universe #oriyabar #photo chahie #Tamilnadu bulls #Gujarat bulls #Indian bulls #tamil songs #Kgf #farming #Cow short video #Kadak dj #Desi #desi Gir Cow farm in Gujarat #Gir cow #gujarat #dairy #Gujarat dairy Farm #punjab #Punjab dairy Farm #Indian dairy Farm #ejjukibusinessideas #Farming Leader #Chernobyl 1986 #New Machine in Farming line #harvester Machine #tractor #Gir gay #Gir cow status #indian cow farm #india Cow Farming #bhavanagar blood line gir Cow #gir cow bull #bull #harvester #agriculture #Gir Cow Lover #Monsterschool #animal matting #caballo perchegon #Ayyappa songs kannada dj #Gola kata #acong #cute #shorts #youtube #youtubeshorts #Biggest Desi Cow Farm in the World #Desi Cow #Desi Cow Far #Desi Cow Farming #Gir Cow Gujarat #short #youtube #desi #gir #cow #buffalo #jafarabadibuffalo #jafarabadi #Buffalo farm #Dairy farm #ejjukibusinessideas #Farning leader #murrah Buffalo #panjab dairy Farm #punjab #punjab buffalo Farm #short #youtube #desi #gir #cow #buffalo #jafarabadibuffalo #jafarabadi #Buffalo farm #Dairy farm #ejjukibusinessideas #Farning leader #Gir jafarabadi Buffalo #jafarabadi bull #gir buffalo #gir jaffarabadi Buffalo #short #youtube #gir #Desi Cow #Cow #farming #Desi #desi Gir Cow farm in Gujarat #Gir cow #gir #Desi Cow #Cow #Kgf songs #martial universe #oriyabar #photo chahie #Tamilnadu bulls #Gujarat bulls #Indian bulls #tamil songs #Kgf #farming #Cow short video #Kadak dj #Desi #desi Gir Cow farm in Gujarat #Gir cow #gujarat #dairy #Gujarat dairy Farm #punjab #shidhumosewalasong #shidhumoosewala #Punjab dairy Farm #Indian dairy Farm #ejjukibusinessideas #Farming Leader #Chernobyl 1986 #New Machine in Farming line #harvester Machine #tractor #Gir gay #Gir cow status #indian cow farm #india Cow Farming #bhavanagar blood line gir Cow #gir cow bull #bull #harvester #agriculture #Gir Cow Lover #Monsterschool #animal matting #caballo perchegon #Ayyappa songs kannada dj #Gola kata #acong #jcb #bannibaffalo #bani #murrah #meshani buffalo #Pure HF Cow Breed #HF Cow #HF Cow Farm #Biggest Hf Cow Farm #Milk 50 K.G. Day #Gir Cow Gujarat #Cow Milking #Cow Milking By Hand #Cow Milking By Boy #Cow Milking By Little Boy #Cow Milking Boy #safa eating food #Cow #Milking #Cow Milking By Hand #Cow Milking By Boy #Cow Milking By Little Boy #Cow Milking Boy #Lion #Attitude #amazing #amazing World #amazingfacts #African lion #Burning Harvester Machine #Harvest Machine

gir cow gujarat

2063
152
0
00:00:08
16.08.2022

Назад
Что ищут прямо сейчас на
gir cow mikrofon عقم в реальной жизни eldahih 借钱 loli no discord в мире cordwood Xiaomi civi в майн foreigners on india carx online ryo yolanda walmsley в кинотеатре Xiaomi Mi Band 5 NFC 인장 вы Новости Таджикистана ахборот таджикистан