Dorayaki pisang

Dorayaki pisang смотреть последние обновления за сегодня на .

PANCAKE PISANG LEMBUT ANTI GAGAL!!

357096
4714
139
00:03:15
19.09.2020

PANCAKE PISANG LEMBUT Bahan-Bahan: 2 buah pisang 10 sdm tepung terigu 1 sdm gula 1/2 sdt baking powder double acting/1 sdt baking powder biasa 1 butir telur 1/4 sdt vanili bubuk 1/4 sdt garam 110 ml susu cair 2 sdm minyak/margarin #pancakepisang #masaksamasaya #dirumahaja

Resep Dorayaki / Pancake 🥞 Pisang , HANYA 1 TELUR ! PAKAI TAKARAN SENDOK

5604
46
5
00:08:02
11.03.2021

cara membuat Dorayaki dari pisang / Bisa juga dijadikan Pancake pisang . untuk posangnya optional ya bisa pakai atau tidak BAHAN - BAHANNYA - Bahan - Bahan : - 1 butir Telur (uk.sedang) - 3,5 sdm gula pasir - Vanilli / Vanilla (secukupnya) - 10 sdm Tepung terigu - ½ Sdt Soda kue - ¼ Baking Powder - 140ml Susu Cair (SKM dicairkan) - 1 sdm Margarin Cair - 2 buah Pisang (optional) Isian : * Selai Coklat * Gula Halus (sesuai selera) . . jangan Lupa Subscribes channel ini .. tunggu resep" menarik lainnya . . Subscribes , Like & Comment follow instagram dibawah ini : dinda_verell8 . Subscribes juga Youtube channel dibawah ini : Dinda Verella . thankyou for watching

PANCAKE PISANG LEMBUT, MUDAH TAKARAN SENDOK

229038
3594
113
00:03:23
22.04.2020

PANCAKE PISANG LEMBUT, MUDAH TAKARAN SENDOK . Pancake Pisang . untuk 6 buah pancake . Bahan-bahan: 1 buah pisang (ukuran sedang) 1 butir telur 3 sdm gula 12 sdm tepung terigu (protein sedang) 1 sdt baking powder 1/8 sdt garam 6 sdm (100ml) susu UHT 1 sdm minyak sayur . Bahan tambahan: sirup maple atau madu potongan pisang . . Banana Pancake . for 6 pancake . Ingredients: 1 banana (medium size) 1 egg 3 sugar 12 tbsp all purpose flour 1 tsp baking powder 1/8 tsp salt 6 tbsp (100ml) whole milk 1 tbsp vegetable oul . additional ingredients: maple syrup or honey banana (cut in pieces) 🌸 PLEASE di LIKE...SUBSCRIBE...COMMENT... & SHARE yaaa😘😍😍THANK YOU dan semoga bergunaa🙏😊😍❤❤ 🌸 Business inquiries: trivinapink🤍gmail.com 🌸 Bagi teman-teman yg sudah nyobain resep-resep dari Trivina Kitchen, tolong di foto atau di video hasilnya yaa dan tolong di Tag 🤍trivinakitchen di Instagram stories. Saya akan repost di story Trivina Kitchen. Terima Kasih🙏😊😍 🌸 My sosial media: Facebook: 🤍 Instagram: 🤍 🌸 Video saya hanya di Upload di Youtube, Facebook dan Instagram milik Trivina Kitchen. Dilarang untuk mencuri, mengedit dan me Reupload video ini. My video is only uploaded to Trivina Kitchen's YouTube, Facebook and Instagram. Unauthorized theft of this video or 2nd edit and reupload is prohibited 🌸Resep Kue lainnya dari Trivina Kitchen BATIK CAKE 🤍 OREO CAKE 🤍 HURRICANE SPONGE CAKE 🤍 #bananapancake #stayathome #trivinakitchen

Resep Dorayaki Pisang/Pancake Pandan Pisang

7015
74
27
00:08:52
16.09.2021

Resep dorayaki atau pancake sederhana ini mempunyai tekstur yang lembut ya,,,,apalagi di padu dengan aroma pandan dan isian pisang yang menjadi pancake pisang ini harum dan enak.. berikut bahan bahannya : Bahan pancake: *200 gr tepung terigu *4 sdm gula pasir *2 butir telur *1 bks santan cair *pewarna pandan *1 sdt baking soda *100 ml air *3 sdm susu bubuk Bahan isian: *3 buah pisang *sejumput garam *1 bkss vanili bubuk *2 sdm gula pasir #pancake #pancakesederhana #pancakelembut #pancakepisang #dorayaki #dorayakiteflon #resepdorayaki #dorayakipisang #idejualan

Resep Dorayaki super lembut dan enak - lebih irit & mudah

905675
12775
504
00:05:04
10.03.2021

#dorayaki #resepdorayaki #doraemon Hallo mommies..Satu lagi nih resep kue tanpa mixer buat cemilan anak anak, rasa dorayaki nya yg lembut & empuk ditambah sama selai kesukaan pasti semua suka. Resep Dorayaki bahan bahan : 2 butir telur 80gr gula pasir 1sdm madu 1 sdt pasta vanilla 130gr tepung terigu 1/2 sdt soda kue 50 ml air Cara membuat : 1. Kocok telur, gula, madu & pasta vanilla kedalam mangkuk. Aduk hingga gulanya larut 2. Masukan terigu, soda kue dan garam sambil di ayak. Aduk rata 3. Tuangkan air, aduk kembali sampai semua bahan tercampur rata 4. Istirahatkan adonan selama 10 menit 5. Siapkan teflon, nyalakan kompor & gunakan api kecil 6. Masukan 1 centong adonan diatas teflon yg sudah dipanaskan. 7. Tunggu sampai keluar gelembung, pecah & membentuk pori pori, lalu balik 8. Masak satu sisinya lagi sampai agak kecoklatan. Angkat 9. Olesi satu sisi dorayaki dengan selai cokelat, lalu tumpuk dengan dorayaki lainnya. Tekan bagian pinggirannya hingga menyatu.

resep pisang dorayaki

1255
34
0
00:00:46
19.05.2022

resep DORAYAKI, mulus, glowing dan bersarang

113794
1570
124
00:08:04
02.12.2020

jangan lupa dukung channel ini dengan cara LIKE, COMMENT, SHARE, SUBCRIBE terimakasih bagi yang sudah mendukung jangan lupa juga di FOLLOW ya.. supaya tidak ketinggalan video terbaru dari kita

Punya Pisang yg terlalu matang dan sudah menghitam,jgn dibuang,dibikin ini saja dijamin jd rebutan

412946
4264
279
00:10:51
17.05.2020

Bahan: 2 buah pisang mateng 2 butir telur 100 ml susu cair 40 gr gula 130 gr tepung protein sedang nah bahanya simple dan mudah yuk tunggu apalagi untuk caranya tonton vidionya ya jgn lupa subscribe dan aktifkan tombol loncengnya trimakasih #olahanpisang #dorayaki #bananapancake

MARTABAK PISANG - IDE BISNIS MODAL KECIL PALING LARIS #196

763494
11603
310
00:07:07
08.08.2020

"Martabak Pisang" Bahan : - 6 buah pisang Ambon kecil - 1 SDM mentega + 2 SDM gula + 1 - 2 SDM maizena - 1 butir telur - 6 SDM maizena - 4 SDM terigu - 3 SDM gula - 1 SDM susu bubuk - 1 sdt backing powder - air secukupnya ✓ [diamkan 15 menit panggang di atas pan] ✓ jika menggunakan pisang kepok/raja nangka/tanduk tidak perlu penambahan maizena.. #MartabakPisang #OlahanPisang #IdeBisnisModalKecil

Dorayaki Pisang

117
27
1
00:02:52
07.07.2020

Membuat dorayaki Pisang ala kak Cello #cello

RESEP DORAYAKI TANPA TELUR

619673
17571
632
00:04:08
25.11.2020

Hallo semuanya kali ini saya akan membuat dorayaki tanpa telur, dorayaki ini sangat enak dan lembut meskipun tanpa telur, dan tentunya mudah dibuat, bahannya sangat sederhana siapapun dapat membuatnya. Maka silahkan menikmati menonton. Resep dorayaki tanpa telur Bahan-bahan : 130 gr tepung terigu serbaguna (segitiga biru) 70 gr gula halus 1/2 sdt soda kue 25 gr susu bubuk 1 sdm madu 160 gr susu cair Filling Hazelnut / bisa di ganti dengan pasta kacang merah Selamat mencoba semoga bermanfaat, dan jangan Lupa Subscribe,Like, Share,Komen iya agar tidak ketinggalan Vidio terbaru selanjutnya Terima kasih. Italian Morning oleh Twin Musicom dilisensikan berdasarkan lisensi Creative Commons Attribution 4.0. 🤍 Artis: 🤍

CEMILAN 3 BAHAN 5 MENIT JADI TEMEN MINUM TEH

596176
5173
181
00:04:28
22.10.2020

CEMILAN 3 BAHAN 5 MENIT JADI TEMEN MINUM TEH Bahan : - 4 buah pisang matang apa aja - 1 butir telur - 3 sdm penuh tepung terigu * jika suka agak manis boleh tambah 1 sdm gula pasir / 1 sdm kental manis * boleh tambahkan sedikit garam Kalau sudah coba resepnya jangan lupa tag green di instagram dan pakai #zackligreen Terimakasih🙂 Instagram : 🤍zackligreen Cara buat : Tonton videonya sampe habis ya teman, karna setiap detiknya ada tips & trik yg biasa ditanyakan agar pembuatan berjalan lancar, semoga berhasil.. Selamat mencoba👌 #cemilan3bahan #pisang

DORAYAKI PISANG SUSU BISA DIJUAL

312
9
0
00:06:36
25.09.2019

Hi, Temen-temen kali ini saya share cara membuat dorayaki pisang susu bisa juga di jual dengan macam isian Bahan 250 gram tepung terigu protein sedang 4 butir telor ayam 50 gram gula pasir 50 sirop pisang susu ( saya pakai tampolay ) 1 sdt baking powder 150 ml air Jika Berkenan Mohon like,share dan subscribe ya semoga bermanfaat

RESEP DORAYAKI PISANG, CAMILAN ENAK KESUKAAN BOCIL

86
0
0
00:04:56
16.11.2022

Yuk bikin dorayaki pisang dijamin simpel dan enak, pas banget buat camilan enak kesukaan bocil bocil, selain enak nggak perlu modal banyak apalagi ditanggal tua begini,, pasti nolong banget buat para mama dirumah yang Anakya doyang ngemil tapi dompet tipis 🤣🤣 Yuk tonton 🤍varendofficial1055 jangan lupa untuk subscribe,like, share, dan komen ya,,, terima kasih 😘😘😘

MURAH BANGET!!! KUE DORAYAKI JUALAN DI PINGGIR JALAN

72051
431
71
00:05:09
23.11.2018

#kubiler #dorayaki #yukmakanyuk Hallo temen-temen Selamat datang di CHANNEL KUBILER, Kuliner Bikin Ngiler "Yuuu Makan Yuuu" Kue DORAYAKI cuma 1.000 ????? SUBSCRIBE I LIKE I SHARE I COMMENT Follow me on INSTAGRAM 🤍

CARA MEMBUAT PANCAKE 2 BAHAN LEMBUT TANPA BAKING POWDER, TAKARAN SENDOK

4358086
68381
3154
00:04:52
10.01.2021

halo semua , kembali lagi di eric’s cooking outside channel , nah kali ini kita akan masak makanan yang simple yang biasa kita makan saat sarapan atau juga bisa di nikmati untuk hidangan penutup dan bisa kita kreasikan sedemikian rupa , nah kali ini kita akan masak pencake , tentu saja menu ini sangat mudah , hanya bermodalkan telur dan tepung kalian sudah bisa membuat menu ini .. jadi ini dia video kita kali ini cara membuat pencake fluffy tanpa baking powder , hanya 2 bahan lembut takaran sendok, jadi ga usah bingung harus ngitung berapa gram berapa gram , karena ini semua memakai takaran sendok ya .. ini dia nih resepnya : 1. tepung terigu self raising flour 180gram / 15sendok makan(kalau tidak ada bisa gunakan tepung terigu protein sedang ditambah 2 sdt baking powder) 2. telur 1 butir thats it! air putih (bahan tambahan) atau bisa gunakan susu 200ml / 20 sendok makan dan gula optional. kalian bisa kreasikan dengan toping sesuai selera ya .. di video ini saya menggunakan madu , namun kalian bisa gunakan susu kental manis atau whip cream atau bisa di kreasikan dengan buah dan saos coklat sesuai selera kalian.. oh ia tonton juga video kita yang ini kalau kalian suka dengan masakan manis .. link di bawah ya .... 🤍 🤍 so thanks for whaching jangan lupa Like, Komen , Share , dan SUBSCRIBE!! peace 🙏🏻😇 #asmrcooking #pancakefluffy #pancakesederhana #pancaketanpabakingpowder #tanpabakingsoda #pancakelembut

RESEP DORAYAKI | JAPANESE PANCAKE DORAYAKI

24928278
949310
17088
00:04:05
06.08.2020

Hallo semuanya kali ini saya akan membuat dorayaki - Japanese pancake dorayaki, dorayaki ini sangat enak, lembut dan mudah dibuat, bahannya sangat sederhana siapapun dapat membuatnya. Maka silahkan menikmati menonton. Bahan-bahan : 2 butir telur 40 gr / 4 sdm gula pasir 1 sdm madu 1/2 sdt Vanilla ekstrak 90 gr / 9 sdm tepung terigu (segitiga biru) 1 sdt baking powder 10 ml / 2 sdm air (bisa di ganti dengan susu cair) Filling Selai coklat kacang / sesuai selera Silahkan Aktifkan subtitel untuk melihat terjemahan teks ke dalam bahasa anda.✅ Jika Anda menyukai video ini, jangan lupa untuk Klik Like dan membagikannya dengan teman-teman Anda, Berlangganan 👇 youtube.com/c/DelmiraCooking Aktifkan lonceng 🔔 untuk mendapatkan notifikasi tentang video terbaru kami, Terima kasih. #dorayaki #pancake #kuedorayaki

cemilan simple dorayaki pisang with better, try this!!! #shortscemilan #dapoerokan

1913
71
2
00:00:59
28.09.2021

🤍DapoerOkan #shortscemilan #olahan pisang

PANCAKE PISANG | TANPA TELUR | ENAK DAN MUDAH

5717
71
19
00:03:41
05.02.2021

PANCAKE PISANG | TANPA TELUR | ENAK DAN MUDAH Bahan-bahan : -2 buah pisang hijau -7 sdm tepung terigu -1 sdm gula pasir -1/4 sdt garam -1/4 sdt baking powder -sejumput vanili bubuk -1 sachet skm -70 ml air -1 ½ sdm minyak goreng Teflon maxim anti lengket : 🤍 Wishker/alat pengocok telur : 🤍 kalau mau tau cara buatnya tonton videonya sampai habis :) Selamat mencoba dan semoga bermanfaat :) Please Subscribe like dan comment ya agar aku lebih semangat lagi dalam membuat video resep-resep sederhana lainnya. Jazakumullohu khoiron :) #pancakepisang#pancakepisangtanpatelur#

Dorayaki - Bamboe Tepung Pisang Goreng

2512
36
3
00:01:33
28.11.2017

Memasak bersama Bumbu Bamboe Bamboe Flour - Tepung Pisang Goreng Dorayaki Facebook: 🤍 Instagram: 🤍 Twitter: 🤍 🤍ptbamboe.com

CARA MEMBUAT PANCAKE PISANG TANPA TELUR || OLAHAN PISANG YANG ENAK BANGET

1953
41
34
00:09:41
26.07.2020

CARA MEMBUAT PANCAKE PISANG TANPA TELUR || OLAHAN PISANG YANG ENAK BANGET Assalmualikum Warrahmatullahi wabarakatuh.. Di video kali saya mau buat olahan dari pisang yaitu dorayaki/pancake pisang.. sebelumnya saya sudah pernah bikin video olahan pisang lainnya silahkan cek videonya disini 🤍 dan 🤍 nah dorayaki/pancake pisang ini bahan2nya juga muudah didapat, dibuat tanpa telur, tanpa mentega tapi rasaanyaa enaakkk, kalian wajib coba.. bahan bahan - 5 buah pisang kecil2 - 4-5 sdm tepung terigu - 2 sdm gulA putih - 1/2 sdt soda kue - 1 sdm white cofee - 4 sdm air putih Untuk cara pembuatannya bisa nonton videonya sampai habis yaa... Follow IG : 🤍 Add FB : 🤍 Terimkasih buat teman2 yang mendukung chanel ini dngn cara nonton, Like ,coment dan subscribe...buat yg belum jangan lupa subscribe yaa dan bagikan ke media sosial kalian, siapatau ada teman kalian yg membutuhkan resep olahan pisang ini, Terimakasih #pancakepisang #pancaketanpatelur #pancakepisangtanpatelur #pancakepisangtanpamentega #pancakepisangummuhanifcooking

Dorayaki Pisang

46
9
6
00:01:19
19.04.2021

Pernah punya pengalaman beli pisang sampai matang sekali sehingga kulit luar pisang berwarna hitam, jadi isinya lembek, bisa loh buat penganan Dorayaki Pisang dengan bahan : - Pisang - Gula - Terigu - Susu Cair - Telur Toping : - Susu kental manis - Gula aren Don't forget to subscribe, like, comment and share my video to supporting my Youtube channel. Find and follow me in: IG : 🤍 Blog : 🤍 Twitter: 🤍 #belajar#masak#masaksendiri#resep#resepmasak

RESEP PANCAKE DORAYAKI PISANG YANG SUDAH TERLALU MATANG.

133
14
2
00:05:18
14.01.2021

#reseppancakedorayaki #reseppancakedorayakipisang #reseppancake #memanfaatkanpisangyangkematangan #resepmenucemilan #caramembuatpancake #dorayakipisang Deskripsi Hai halo Assalamu'alaikum di video kali ini aku mau membuat pancake dorayaki pisang yang enak banget kesukaan anak-anak tentunya.. aroma pisang nya mantap banget nonton terus video nya sampai habis ya happy watching thank you bahan tepung terigu 13 sdm gula pasir 3 sdm pisang yang sudah kematangan 3 buah susu uht/ cair 200 ml telur 1 butir baking powder 1/2 sdt garam 1/2 sdt minyak goreng 2 sdm untuk caranya bisa dilihat di video ya Subscribe ya karena subscribe itu gratis...

Cara Membuat Dorayaki Anti Gagal

77087
3749
53
00:01:00
23.06.2021

Berikut cara membuat dorayaki anti gagal yang mudah. Untuk resep dorayaki ini menggunakan bahan-bahan yang sederhana dan mudah didapat. Simak videonya sampai selesai dan dukung channel ini dengan cara subscribe, like dan share. Dengan cara gratis ini teman-teman akan selalu mendapatkan resep-resep praktis dari saya. Terimakasih Resep Dorayaki: 1 bt telur 1 sdm gula (14 g) 1/8 sdt garam 1 sdt air (5 ml) 3 sdm terigu serbaguna (30 g) ½ sdt baking powder Isian: selai/ coklat filling #dorayaki #japanesepancake #dorayakirecipe #shorts

Dorayaki Pisang Chia Seeds

8
0
0
00:00:32
14.04.2021

Dorayaki Pisang Chia Seeds dengan susu cair Morinaga Chil*Go! Original

Membuat dorayaki selai coklat lumer dengan isian pisang. Resep dorayaki. Japanese pancake dorayaki.

2405
93
2
00:04:32
13.06.2022

Membuat dorayaki selai coklat lumer dengan isian pisang. Resep dorayaki. Japanese pancake dorayaki. ● Follow me on Instagram : 🤍 Recipe : (Cake Dorayaki) 140 gr flour (140 gr tepung terigu) 2 egg (2 telur) 85 gr granulated sugar (85 gr gula pasir) 1 tbsp honey (1 sdm madu) 1/2 tsp baking powder (1/2 sdt baking powder) 160 ml fresh milk (160 ml susu cair) 1,4 gr vanillie powder (1,4 gr vanili bubuk (Jam Chocolate) 44 gr milo powder (44 gr / 2 sacet milo) 20 gr chocolate powder (20 gr bubuk coklat) 20 gr flour (20 gr tepung terigu) 40 gr granulated sugar (40 gr gula pasir) 200 ml fresh milk (200 ml susu cair) 35 gr margarine (35 gr margarin) 1 tbsp sweet condensed milk (1 sdm susu kental manis) 2 banana (2 buah pisang) #resepdorayaki #recipedorayaki #dorayaki

SAYA SENANG MEMBUAT KUE LEZAT INI!! SUPER ENAK DAN LAKU DALAM SEKEJAP - RESEP KUE DORAYAKI JUAL 1000

244895
4214
275
00:08:01
06.06.2022

#dorayaki #dorayaki1000an #idejualanmodalsedikit #jajanansd #keluargahamzah Assalamualaikum, inget Doremon inget Dorayaki 🤭 Yuk buat anak-anak suka. DORAYAKI 1000AN by 🤍KELUARGAHAMZAH Wajan Crepes / Wajan Datar Diameter 28 cm 🤍 Bahan-bahan: 1 butir telur ayam (1500) 1,5 sdm gula pasir 1/4 sdt garam 1/2 sdt Soda Kue/ Baking Powder 100gr terigu (1000) 100ml air 50gr selai cokelat (1000) Gas + Mika (2000) Jual sesuaikan di tempat masing-masing. Kalau aku jual 1000an yang penting lancar ☺️ Terus dukung chanel kami dengan Like, Komen, dan Subscribe. Follow juga yuk 👇 Facebook 🤍 Instagram 🤍 Tik Tok 🤍 Perlengkapan aku beli disini 👇 Loyang Pizza Mini Diameter 8 Cm 🤍 Wajan Crepes / Wajan Datar Diameter 28 cm 🤍 Teflon Maxim 20 Cm 🤍 Batu Bakar Granito 🤍 Sosis Sobat 🤍 Timbangan Digital Nankai 🤍 Wadah Thinwall Persegi Panjang 1000ml 🤍 Cetakan Takoyaki 25 Lubang 🤍 Mie Lidi & Mie Gepeng Mentah 500gr 🤍 Saos Mc Lewis 500gr 🤍 Cetakan Permen Squid Game 🤍 Plastik Es Mambo Ukuran 3x20cm 🤍 Cetakan Puding Telur Puyuh 🤍 Suntikan Mainan Anak - Anak/ Spuit 🤍 Standing Pouch Minuman / Drinkpack ukuran 9x15 Cm 🤍 Mesin Gilingan Mie / Alat Pembuat Mie 🤍 Cetakan Puding Ikan Koi Kecil 🤍 Stick Es Krim Kayu Tebal 🤍 #idebisnisrumahan #idebisniskekinian #idebisnisrumahtangga #jajananterbaru #jajananviralkekinian #jajananviral #jajananenak #jajanansd #jajananunikkekinian #jajananunikmurahmeriah1000an #idejualan1000an #resepdorayaki #dorayakisederhana #keluargahamzah

RESEP PANCAKE LIPAT VLA PISANG | IDE JUALAN IDE CEMILAN YG UNIK DAN SIMEPL

3141
73
65
00:07:18
18.01.2021

🌷 RESEP PANCAKE 🌷 Bagi temen temen yang suka ngemil dan jualan ini wajib di coba banget bahannya yg sederhana dan buatnya juga cepat rasanya eneak banget Yuk simak bahan bahannya ya Bahan pencake 300 grm tepung terigu 2 sdm susu bubuk 1 sdt beking soda 7 sdm gula pasir 1/4 sdt garam Sejumput vanili bubuk 1 butir telur 400 mil air Bahan vla 4 buah pisang ambon 1 sdm gula pasir 1 sdm tepung maizina 2 sdm mentega /minyak Untunk cara membuat nya silahkan tonton videonya sampai selesai ya Terimakasih _ Jangan lupa dukung cenel ini dengan cara SUBSCREB LIKE & KOMEN TERIMAKASIH _ #pancake #recipepancake #bananpancake #reseppancake #pancakelipatvlapandan #caramembuatpancake #pancakebanana

Olahan pisang ambon [ Dorayaki pisang keju susu]

438
89
85
00:08:33
24.03.2021

Dorayaki adalah kue yang berasal dari Jepang. Dorayaki termasuk ke dalam golongan kue tradisional Jepang. Kue ini bentuknya bundar sedikit menul. Dorayaki pisang keju susu Bahan - bahan : 4 buah pisang 300 gr tepung terigu 5 sdm gula pasir 1/2 sdt garam 1 bks vanili bubuk 1 sdt baking powder 1 sdt baking soda 2 butir telur 3 sdm mentega cair air secukupnya Isian : Keju cheddar Susu kental manis [Boleh isian selai coklat atau sesuai selera] Cara membuat bisa dilihat di video nya ya, Moms. Terima kasih sudah mampir di channel Mami May, semoga suka dan bermanfaat. Jika suka, boleh like, komen dan share yaa.

DORAYAKI PISANG ((Tugasan Akhir Semester))

11
3
1
00:10:49
23.03.2021

Created by InShot 🤍

Dorayaki Pisang, Olahan Sehat Antidiare - OKK RK 101

23
2
0
00:03:52
05.01.2022

Halo semuaa. Di video kali ini, kami dari kelompok OKK RK 101 ingin berbagi resep masakan sehat yang berkhasiat bagi tubuh untuk mencegah penyakit diare, yaitu membuat dorayaki pisang! Pada tau gak, pisang itu bermanfaat loh untuk mencegah diare. Yuk, simak pembuatannya di video ini. Selamat mencoba ! 😆☺️ Tim 3 OKK RK 101: 1. Abner Abhista Triyono (110110210335) 2. Alya Oktari (120104210017) 3. Angelica Febri Maribeth Valentina Siregar (160110210029) 4. Grace Victory (170304210039)

Назад
Что ищут прямо сейчас на
dorayaki pisang asap rocky welfare 魏晨 kolsch grey kolsch live vivir en sao paulo scj pericol gaming 口交 bible prophecy perikanan backyardchickens karmaisreal karmafonlar exponencial crazyraccoon crazymegahell sleep rain music 窒素